| Clone Name | rbags25m03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HISZ_AQUAE (O67223) ATP phosphoribosyltransferase regulatory sub... | 32 | 1.3 | 2 | PHK_PARUW (Q6MFC0) Probable phosphoketolase (EC 4.1.2.-) | 30 | 3.8 | 3 | PHK2_ANASP (Q8YTZ6) Probable phosphoketolase 2 (EC 4.1.2.-) | 30 | 6.5 | 4 | PHK_RHILO (Q988V7) Probable phosphoketolase (EC 4.1.2.-) | 29 | 8.5 |
|---|
>HISZ_AQUAE (O67223) ATP phosphoribosyltransferase regulatory subunit| Length = 383 Score = 32.0 bits (71), Expect = 1.3 Identities = 19/80 (23%), Positives = 39/80 (48%), Gaps = 2/80 (2%) Frame = -2 Query: 267 ALVLSSRYQRQKWGLSSDSTSTAWAPIQSRKLIVNSCHWAEARSCNHVFTYGKLFTLDVL 88 A+ Y ++ +GL D T+ +++ H + V+ +GK+F+LD Sbjct: 61 AITFKDSYTKESFGLRLDFTT---------QVVRTISHLRNVKLPERVYYFGKVFSLDRR 111 Query: 87 GFKNLE--VEFLASRNXLSN 34 GF+ L+ VE + ++ L++ Sbjct: 112 GFEKLQTGVELIGEKSILAD 131
>PHK_PARUW (Q6MFC0) Probable phosphoketolase (EC 4.1.2.-)| Length = 798 Score = 30.4 bits (67), Expect = 3.8 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 3/70 (4%) Frame = -3 Query: 392 YWA---FLRLKQNHLLNKPWNREDENISSCRPKGYDQGRVKPECQPSYCHLDIRDKSGDY 222 YW +L + Q +LL+ P ++ +I +P+ P Y HL+ K D Sbjct: 26 YWRAANYLSVGQIYLLDNPLLKKPLSIKDIKPRLLGHWGTTPGLNFIYVHLNRIIKKFDL 85 Query: 221 HQILLVLPGH 192 I L+ PGH Sbjct: 86 DMIYLIGPGH 95
>PHK2_ANASP (Q8YTZ6) Probable phosphoketolase 2 (EC 4.1.2.-)| Length = 793 Score = 29.6 bits (65), Expect = 6.5 Identities = 20/70 (28%), Positives = 29/70 (41%), Gaps = 3/70 (4%) Frame = -3 Query: 392 YWA---FLRLKQNHLLNKPWNREDENISSCRPKGYDQGRVKPECQPSYCHLDIRDKSGDY 222 YW +L + Q +LL+ P RE N +P+ P Y HL+ K D Sbjct: 23 YWRAANYLSVGQIYLLDNPLLREPLNKEHVKPRLLGHWGTTPGLNFIYVHLNRIIKKYDQ 82 Query: 221 HQILLVLPGH 192 + + PGH Sbjct: 83 SMVYIAGPGH 92
>PHK_RHILO (Q988V7) Probable phosphoketolase (EC 4.1.2.-)| Length = 807 Score = 29.3 bits (64), Expect = 8.5 Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 3/70 (4%) Frame = -3 Query: 392 YWA---FLRLKQNHLLNKPWNREDENISSCRPKGYDQGRVKPECQPSYCHLDIRDKSGDY 222 YW +L + Q +LL+ P RE + +P+ P Y HL+ + D Sbjct: 25 YWRAANYLTIGQIYLLDNPLLREPLRLEHVKPRLLGHWGTSPGLSFIYAHLNRAIRLRDA 84 Query: 221 HQILLVLPGH 192 + I + PGH Sbjct: 85 NVIYICGPGH 94 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,963,463 Number of Sequences: 219361 Number of extensions: 1737354 Number of successful extensions: 3727 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3727 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)