| Clone Name | rbags26a22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LASS1_MOUSE (P27545) LAG1 longevity assurance homolog 1 (UOG-1 p... | 28 | 4.3 | 2 | Y123_THEMA (Q9WXX7) Putative periplasmic metal-binding protein T... | 28 | 5.6 | 3 | IF1A2_HALSA (Q9HP87) Translation initiation factor 1A-2 (aIF-1A-2) | 27 | 9.6 | 4 | Y281_HAEIN (P44610) Hypothetical metabolite transport protein HI... | 27 | 9.6 | 5 | DMD_MOUSE (P11531) Dystrophin | 27 | 9.6 |
|---|
>LASS1_MOUSE (P27545) LAG1 longevity assurance homolog 1 (UOG-1 protein)| Length = 350 Score = 28.5 bits (62), Expect = 4.3 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Frame = +1 Query: 67 LSVLTKTVHCSMSSSLWLQ*YFYF----LLIHLQGIFFFL 174 L VL T HCS+ S + YF+F LL+ + I++FL Sbjct: 261 LKVLYATCHCSLQSVPDIPYYFFFNILLLLLMVMNIYWFL 300
>Y123_THEMA (Q9WXX7) Putative periplasmic metal-binding protein TM0123| precursor Length = 267 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 153 PGYLFFFKXMPTELTNLSMGHSRSQS 230 P + +FFK EL LS GH S S Sbjct: 173 PSFTYFFKEFGLELITLSSGHEHSTS 198
>IF1A2_HALSA (Q9HP87) Translation initiation factor 1A-2 (aIF-1A-2)| Length = 94 Score = 27.3 bits (59), Expect = 9.6 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -3 Query: 158 PWRWMSKK*KYHWSQSDDDIEQ 93 PW W +K W SD D +Q Sbjct: 65 PWDWQDEKANVEWRYSDQDADQ 86
>Y281_HAEIN (P44610) Hypothetical metabolite transport protein HI0281| Length = 438 Score = 27.3 bits (59), Expect = 9.6 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 60 FGAQRSYKDSPLLDVIITLAPVILLFFAHPPPGYLF 167 F Q + D PL + +++L+ + L FFA P LF Sbjct: 38 FNTQFFHSDDPLSNDLLSLSTLALAFFARPIGSALF 73
>DMD_MOUSE (P11531) Dystrophin| Length = 3678 Score = 27.3 bits (59), Expect = 9.6 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -3 Query: 176 FKKKKIPWRWMSKK*KYHWSQSDDDIEQWTVFVRTLSS 63 FKK + P W K K++ + D I Q VRTL++ Sbjct: 2129 FKKTQNPENWEHAKYKWYLKELQDGIGQRQAVVRTLNA 2166 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,930,937 Number of Sequences: 219361 Number of extensions: 657805 Number of successful extensions: 1623 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1623 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)