ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags26a12 |
|---|---|
| Clone Library Name | barley_pub |
>ADT1_WHEAT (Q41629) ADP,ATP carrier protein 1, mitochondrial precursor| (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) Length = 331 Score = 116 bits (290), Expect = 4e-26 Identities = 59/61 (96%), Positives = 59/61 (96%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 311 AVKYKSSLDAF QIL KEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG Sbjct: 271 AVKYKSSLDAFQQILKKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 330 Query: 310 A 308 A Sbjct: 331 A 331
>ADT2_WHEAT (Q41630) ADP,ATP carrier protein 2, mitochondrial precursor| (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2) Length = 331 Score = 115 bits (288), Expect = 6e-26 Identities = 59/61 (96%), Positives = 59/61 (96%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 311 AVKYKSSLDAF QI AKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG Sbjct: 271 AVKYKSSLDAFQQIPAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 330 Query: 310 A 308 A Sbjct: 331 A 331
>ADT2_MAIZE (P12857) ADP,ATP carrier protein 2, mitochondrial precursor| (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2) Length = 387 Score = 114 bits (285), Expect = 1e-25 Identities = 58/61 (95%), Positives = 58/61 (95%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 311 AVKYKSSLDAF QIL KEG KSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG Sbjct: 327 AVKYKSSLDAFQQILKKEGPKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 386 Query: 310 A 308 A Sbjct: 387 A 387 Score = 28.9 bits (63), Expect = 7.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILR 392 YK D F + + EG SL++G AN++R Sbjct: 131 YKGIADCFKRTIKDEGFSSLWRGNTANVIR 160
>ADT1_MAIZE (P04709) ADP,ATP carrier protein 1, mitochondrial precursor| (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) Length = 387 Score = 114 bits (285), Expect = 1e-25 Identities = 58/61 (95%), Positives = 58/61 (95%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 311 AVKYKSSLDAF QIL KEG KSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG Sbjct: 327 AVKYKSSLDAFQQILKKEGPKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 386 Query: 310 A 308 A Sbjct: 387 A 387 Score = 29.6 bits (65), Expect = 4.5 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILR 392 YK +D F + + EG SL++G AN++R Sbjct: 131 YKGIVDCFKRTIKDEGFSSLWRGNTANVIR 160
>ADT_ORYSA (P31691) ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP| translocase) (Adenine nucleotide translocator) (ANT) Length = 382 Score = 114 bits (284), Expect = 2e-25 Identities = 57/61 (93%), Positives = 59/61 (96%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 311 AVKYKSS+DAF+QIL EGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG Sbjct: 322 AVKYKSSMDAFSQILKNEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 381 Query: 310 A 308 A Sbjct: 382 A 382
>ADT1_ARATH (P31167) ADP,ATP carrier protein 1, mitochondrial precursor| (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) Length = 381 Score = 108 bits (269), Expect = 1e-23 Identities = 53/61 (86%), Positives = 57/61 (93%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 311 AVKYKSSLDAF QIL EGAKSLFKGAGANILRA+AGAGVLSGYD+LQ++ FGKKYGSGG Sbjct: 321 AVKYKSSLDAFKQILKNEGAKSLFKGAGANILRAVAGAGVLSGYDKLQLIVFGKKYGSGG 380 Query: 310 A 308 A Sbjct: 381 A 381
>ADT2_ARATH (P40941) ADP,ATP carrier protein 2, mitochondrial precursor| (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2) Length = 385 Score = 106 bits (265), Expect = 3e-23 Identities = 51/61 (83%), Positives = 58/61 (95%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 311 AVKYKSS DAF+QI+ KEGAKSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGG Sbjct: 325 AVKYKSSFDAFSQIVKKEGAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGG 384 Query: 310 A 308 A Sbjct: 385 A 385
>ADT1_GOSHI (O22342) ADP,ATP carrier protein 1, mitochondrial precursor| (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) Length = 386 Score = 105 bits (261), Expect = 8e-23 Identities = 51/61 (83%), Positives = 57/61 (93%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 311 AVKYKSSLDAF+QIL EG KSLFKGAG+NILRAIAGAGVL+GYD+LQ++ FGKKYGSGG Sbjct: 326 AVKYKSSLDAFSQILKNEGGKSLFKGAGSNILRAIAGAGVLAGYDKLQLIVFGKKYGSGG 385 Query: 310 A 308 A Sbjct: 386 A 386
>ADT2_SOLTU (P27081) ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP| translocase) (Adenine nucleotide translocator) (ANT) (Fragment) Length = 386 Score = 104 bits (259), Expect = 1e-22 Identities = 49/60 (81%), Positives = 55/60 (91%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 311 AVKYKSS DAFNQIL EG KSLFKGAGAN+LRA+AGAGVL+GYD+LQ++ FGKKYGSGG Sbjct: 326 AVKYKSSFDAFNQILKNEGPKSLFKGAGANVLRAVAGAGVLAGYDKLQVIVFGKKYGSGG 385
>ADT1_SOLTU (P25083) ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP| translocase) (Adenine nucleotide translocator) (ANT) Length = 386 Score = 101 bits (252), Expect = 9e-22 Identities = 49/61 (80%), Positives = 56/61 (91%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 311 AVKYKSSLDAF+QI+ EG KSLFKGAGANILRA+AGAGVL+GYD+LQ+L GKK+GSGG Sbjct: 326 AVKYKSSLDAFSQIVKNEGPKSLFKGAGANILRAVAGAGVLAGYDKLQVLVLGKKFGSGG 385 Query: 310 A 308 A Sbjct: 386 A 386
>ADT_CHLRE (P27080) ADP,ATP carrier protein (ADP/ATP translocase) (Adenine| nucleotide translocator) (ANT) Length = 308 Score = 92.0 bits (227), Expect = 7e-19 Identities = 44/61 (72%), Positives = 50/61 (81%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGG 311 AVKY SS F +I+ EG KSLFKGAGANILRA+AGAGVL+GYDQLQ++ GKKYGSG Sbjct: 248 AVKYNSSFHCFQEIVKNEGMKSLFKGAGANILRAVAGAGVLAGYDQLQVILLGKKYGSGE 307 Query: 310 A 308 A Sbjct: 308 A 308
>ADT_NEUCR (P02723) ADP,ATP carrier protein (ADP/ATP translocase) (Adenine| nucleotide translocator) (ANT) Length = 313 Score = 90.5 bits (223), Expect = 2e-18 Identities = 45/59 (76%), Positives = 50/59 (84%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSG 314 AVKYKSS DA +QI+AKEG KSLFKGAGANILR +AGAGVLS YDQLQ+L FGK + G Sbjct: 253 AVKYKSSFDAASQIVAKEGVKSLFKGAGANILRGVAGAGVLSIYDQLQVLLFGKAFKGG 311 Score = 28.9 bits (63), Expect = 7.7 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR 392 +Y +D F + A EG +L++G AN++R Sbjct: 56 RYNGIIDCFKRTTADEGVMALWRGNTANVIR 86
>ADT_SCHPO (Q09188) ADP,ATP carrier protein (ADP/ATP translocase) (Adenine| nucleotide translocator) (ANT) Length = 322 Score = 84.0 bits (206), Expect = 2e-16 Identities = 41/56 (73%), Positives = 47/56 (83%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKY 323 AVKY SS + QILAKEGA+S FKGAGANILR +AGAGVLS YDQ+Q+L FGKK+ Sbjct: 267 AVKYSSSFECGRQILAKEGARSFFKGAGANILRGVAGAGVLSIYDQVQLLMFGKKF 322 Score = 29.3 bits (64), Expect = 5.9 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGY-DQLQILFFGKKYGSGGA 308 +YK + F + A+EG SL++G AN+LR + + D+ + +F KK G A Sbjct: 70 RYKGIGECFKRTAAEEGVISLWRGNTANVLRYFPTQALNFAFKDKFKKMFGYKKERDGYA 129
>ADT_KLULA (P49382) ADP,ATP carrier protein (ADP/ATP translocase) (Adenine| nucleotide translocator) (ANT) Length = 305 Score = 79.7 bits (195), Expect = 4e-15 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKY 323 AVKY + DAF +I+A EG KSLFKG GANILR +AGAGV+S YDQLQ++ FGK + Sbjct: 249 AVKYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVISMYDQLQVILFGKTF 304
>ADT3_YEAST (P18238) ADP,ATP carrier protein 3 (ADP/ATP translocase 3) (Adenine| nucleotide translocator 3) (ANT 3) Length = 307 Score = 77.0 bits (188), Expect = 2e-14 Identities = 35/56 (62%), Positives = 45/56 (80%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKY 323 AVKY ++D +I+A EG SLFKG GANILR++AGAGV+S YDQLQ++ FGKK+ Sbjct: 251 AVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQMILFGKKF 306 Score = 29.6 bits (65), Expect = 4.5 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGY-DQLQILF-FGKKYGSG 314 KY +D F + +EG S ++G AN++R + + D+++++F F K+ G G Sbjct: 55 KYSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYG 113
>ADT2_YEAST (P18239) ADP,ATP carrier protein 2 (ADP/ATP translocase 2) (Adenine| nucleotide translocator 2) (ANT 2) Length = 318 Score = 75.1 bits (183), Expect = 9e-14 Identities = 35/56 (62%), Positives = 43/56 (76%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKY 323 AVKY + D +I+A EG SLFKG GANILR +AGAGV+S YDQLQ++ FGKK+ Sbjct: 262 AVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGVISMYDQLQMILFGKKF 317 Score = 29.3 bits (64), Expect = 5.9 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGY-DQLQILFFGKK 326 KY LD F + +EG S ++G AN++R + + D+++ +F KK Sbjct: 66 KYAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKK 119
>ADT1_YEAST (P04710) ADP,ATP carrier protein 1 (ADP/ATP translocase 1) (Adenine| nucleotide translocator 1) (ANT 1) Length = 309 Score = 72.8 bits (177), Expect = 5e-13 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKY 323 +KY +LD +I+ KEGA SLFKG GANI R +A AGV+S YDQLQ++ FGKK+ Sbjct: 254 IKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGVISLYDQLQLIMFGKKF 308 Score = 29.6 bits (65), Expect = 4.5 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR 392 +YK LD F + EG S ++G AN+LR Sbjct: 56 RYKGILDCFKRTATHEGIVSFWRGNTANVLR 86
>ADT3_BOVIN (P32007) ADP/ATP translocase 3 (Adenine nucleotide translocator 2)| (ANT 3) (ADP,ATP carrier protein 3) (Solute carrier family 25 member 6) (ADP,ATP carrier protein, isoform T2) (ANT 2) Length = 297 Score = 48.9 bits (115), Expect = 7e-06 Identities = 22/47 (46%), Positives = 33/47 (70%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 + YK ++D + +IL EG K+ FKGA +N+LR + GA VL YD+L+ Sbjct: 248 IMYKGTVDCWRKILKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK 294
>ADT3_PIG (Q6QRN9) ADP/ATP translocase 3 (Adenine nucleotide translocator 2)| (ANT 3) (ADP,ATP carrier protein 3) (Solute carrier family 25 member 6) Length = 297 Score = 48.5 bits (114), Expect = 9e-06 Identities = 22/47 (46%), Positives = 32/47 (68%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 + YK +LD + +I EG K+ FKGA +N+LR + GA VL YD+L+ Sbjct: 248 IMYKGTLDCWRKIFKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK 294
>ADT2_BOVIN (Q8SQH5) ADP/ATP translocase 2 (Adenine nucleotide translocator 2)| (ANT 2) (ADP,ATP carrier protein 2) (Solute carrier family 25 member 5) Length = 297 Score = 46.6 bits (109), Expect = 4e-05 Identities = 21/47 (44%), Positives = 32/47 (68%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 + Y +LD + +I EGAK+ FKGA +N+LR + GA VL YD+++ Sbjct: 248 IMYTGTLDCWRKIARDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIK 294
>ADT2_MOUSE (P51881) ADP/ATP translocase 2 (Adenine nucleotide translocator 2)| (ANT 2) (ADP,ATP carrier protein 2) (Solute carrier family 25 member 5) Length = 297 Score = 45.4 bits (106), Expect = 8e-05 Identities = 20/47 (42%), Positives = 32/47 (68%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 + Y +LD + +I EG+K+ FKGA +N+LR + GA VL YD+++ Sbjct: 248 IMYTGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIK 294
>ADT1_RABIT (O46373) ADP/ATP translocase 1 (Adenine nucleotide translocator 1)| (ANT 1) (ADP,ATP carrier protein 1) (Solute carrier family 25 member 4) (30 kDa calsequestrin-binding protein) (CSQ-binding 30 kDa protein) Length = 297 Score = 45.4 bits (106), Expect = 8e-05 Identities = 20/47 (42%), Positives = 32/47 (68%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 + Y ++D + +I EGAK+ FKGA +N+LR + GA VL YD+++ Sbjct: 248 IMYTGTVDCWKKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIK 294
>ADT1_HUMAN (P12235) ADP/ATP translocase 1 (Adenine nucleotide translocator 1)| (ANT 1) (ADP,ATP carrier protein 1) (Solute carrier family 25 member 4) (ADP,ATP carrier protein, heart/skeletal muscle isoform T1) Length = 297 Score = 45.4 bits (106), Expect = 8e-05 Identities = 20/47 (42%), Positives = 32/47 (68%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 + Y ++D + +I EGAK+ FKGA +N+LR + GA VL YD+++ Sbjct: 248 IMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIK 294
>ADT3_HUMAN (P12236) ADP/ATP translocase 3 (Adenine nucleotide translocator 2)| (ANT 3) (ADP,ATP carrier protein 3) (Solute carrier family 25 member 6) (ADP,ATP carrier protein, isoform T2) Length = 297 Score = 45.1 bits (105), Expect = 1e-04 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 + Y ++D + +I EG K+ FKGA +N+LR + GA VL YD+L+ Sbjct: 248 IMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK 294
>ADT2_RAT (Q09073) ADP/ATP translocase 2 (Adenine nucleotide translocator 2)| (ANT 2) (ADP,ATP carrier protein 2) (Solute carrier family 25 member 5) Length = 297 Score = 45.1 bits (105), Expect = 1e-04 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 + Y +LD + +I EG K+ FKGA +N+LR + GA VL YD+++ Sbjct: 248 IMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIK 294
>ADT2_HUMAN (P05141) ADP/ATP translocase 2 (Adenine nucleotide translocator 2)| (ANT 2) (ADP,ATP carrier protein 2) (Solute carrier family 25 member 5) (ADP,ATP carrier protein, fibroblast isoform) Length = 297 Score = 45.1 bits (105), Expect = 1e-04 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 + Y +LD + +I EG K+ FKGA +N+LR + GA VL YD+++ Sbjct: 248 IMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIK 294
>ADT1_MOUSE (P48962) ADP/ATP translocase 1 (Adenine nucleotide translocator 1)| (ANT 1) (ADP,ATP carrier protein 1) (Solute carrier family 25 member 4) (ADP,ATP carrier protein, heart/skeletal muscle isoform T1) (mANC1) Length = 297 Score = 44.7 bits (104), Expect = 1e-04 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 + Y +LD + +I EGA + FKGA +N+LR + GA VL YD+++ Sbjct: 248 IMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIK 294
>ADT1_ANOGA (Q27238) ADP,ATP carrier protein 1 (ADP/ATP translocase 1) (Adenine| nucleotide translocator 1) (ANT 1) Length = 301 Score = 43.9 bits (102), Expect = 2e-04 Identities = 22/49 (44%), Positives = 34/49 (69%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQIL 341 V YK++LD + +I +EG+ + FKGA +N+LR GA VL YD+++ L Sbjct: 251 VMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLRGTGGALVLVFYDEVKAL 299
>ADT2_PONPY (Q5R5A1) ADP/ATP translocase 2 (Adenine nucleotide translocator 2)| (ANT 2) (ADP,ATP carrier protein 2) (Solute carrier family 25 member 5) Length = 297 Score = 43.5 bits (101), Expect = 3e-04 Identities = 19/47 (40%), Positives = 30/47 (63%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 + Y +LD + +I EG K+ FKGA +N+LR + GA L YD+++ Sbjct: 248 IMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFALVLYDEIK 294
>ADT1_RAT (Q05962) ADP/ATP translocase 1 (Adenine nucleotide translocator 1)| (ANT 1) (ADP,ATP carrier protein 1) (Solute carrier family 25 member 4) Length = 297 Score = 43.5 bits (101), Expect = 3e-04 Identities = 19/47 (40%), Positives = 31/47 (65%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 + Y ++D + +I EG K+ FKGA +N+LR + GA VL YD+++ Sbjct: 248 IMYTGTVDCWRKIAKDEGRKAFFKGAWSNVLRGMGGAFVLVLYDEIK 294
>ADT1_BOVIN (P02722) ADP/ATP translocase 1 (Adenine nucleotide translocator 1)| (ANT 1) (ADP,ATP carrier protein 1) (Solute carrier family 25 member 4) (ADP,ATP carrier protein, heart isoform T1) Length = 297 Score = 43.5 bits (101), Expect = 3e-04 Identities = 19/47 (40%), Positives = 31/47 (65%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 + Y ++D + +I EG K+ FKGA +N+LR + GA VL YD+++ Sbjct: 248 IMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIK 294
>ADT_CHLKE (P31692) ADP,ATP carrier protein (ADP/ATP translocase) (Adenine| nucleotide translocator) (ANT) Length = 339 Score = 43.5 bits (101), Expect = 3e-04 Identities = 18/46 (39%), Positives = 31/46 (67%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 +Y ++D + ++ +EG K+ FKGA +N+LR GA VL YD+++ Sbjct: 281 QYNGTIDCWRKVAQQEGMKAFFKGAWSNVLRGAGGAFVLVLYDEIK 326
>CMC2_HUMAN (Q9UJS0) Calcium-binding mitochondrial carrier protein Aralar2| (Mitochondrial aspartate glutamate carrier 2) (Solute carrier family 25 member 13) (Citrin) Length = 675 Score = 40.8 bits (94), Expect = 0.002 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGV-LSGYDQLQILFF 335 Y +D F +IL +EG K+L+KGAGA + R+ GV L Y+ LQ F+ Sbjct: 559 YSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTYELLQRWFY 608
>ADT_DROME (Q26365) ADP,ATP carrier protein (ADP/ATP translocase) (Adenine| nucleotide translocator) (ANT) (Stress sensitive B protein) Length = 312 Score = 40.4 bits (93), Expect = 0.003 Identities = 21/47 (44%), Positives = 30/47 (63%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 V YK++L + I +EG + FKGA +NILR GA VL YD+++ Sbjct: 263 VIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIK 309
>ADT2_ANOGA (Q7PQV7) ADP,ATP carrier protein 2 (ADP/ATP translocase 2) (Adenine| nucleotide translocator 2) (ANT 2) Length = 300 Score = 39.7 bits (91), Expect = 0.004 Identities = 19/47 (40%), Positives = 29/47 (61%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQ 347 + YK +L + I +EG + FKGA +N+LR GA VL YD+++ Sbjct: 251 IVYKGTLHCWATIAKQEGTGAFFKGAFSNVLRGTGGAFVLVLYDEIK 297
>MCAT_ARATH (Q93XM7) Mitochondrial carnitine/acylcarnitine carrier-like protein| (Protein A BOUT DE SOUFFLE) (Carnitine/acylcarnitine translocase-like protein) (CAC-like protein) Length = 300 Score = 37.0 bits (84), Expect = 0.028 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILRAI-AGAGVLSGYD 356 +Y S+DAF +IL EG K L+KG G + R++ A A Y+ Sbjct: 250 RYTGSMDAFRKILKSEGVKGLYKGFGPAMARSVPANAACFLAYE 293 Score = 33.9 bits (76), Expect = 0.24 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVL 368 +Y ++DA Q +A EG K L+KG GA + A VL Sbjct: 45 RYTGAIDAVKQTVASEGTKGLYKGMGAPLATVAAFNAVL 83
>UCP2_BRARE (Q9W720) Mitochondrial uncoupling protein 2 (UCP 2)| Length = 310 Score = 36.2 bits (82), Expect = 0.048 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR-AIAGAGVLSGYDQLQ 347 +Y S++DA+ I +EG + L+KG G NI R AI L YD ++ Sbjct: 156 RYHSTMDAYRTIAKEEGFRGLWKGTGPNITRNAIVNCTELVTYDLIK 202
>CMC2_MOUSE (Q9QXX4) Calcium-binding mitochondrial carrier protein Aralar2| (Mitochondrial aspartate glutamate carrier 2) (Solute carrier family 25 member 13) (Citrin) Length = 676 Score = 35.8 bits (81), Expect = 0.063 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGV-LSGYDQLQILFF 335 Y D F +IL +EG K+L+KG A + R+ GV L Y+ LQ F+ Sbjct: 560 YNGVTDCFRKILREEGPKALWKGVAARVFRSSPQFGVTLLTYELLQRWFY 609
>UCP2_PIG (O97562) Mitochondrial uncoupling protein 2 (UCP 2)| Length = 309 Score = 35.4 bits (80), Expect = 0.082 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR-AIAGAGVLSGYDQLQ 347 +Y+S++DA+ I +EG + L+KG N+ R AI L YD ++ Sbjct: 155 RYRSTVDAYKTIAREEGLRGLWKGTSPNVARNAIVNCAELVTYDLIK 201
>DNC_PONPY (Q5NVC1) Mitochondrial deoxynucleotide carrier (Solute carrier| family 25 member 19) Length = 320 Score = 35.4 bits (80), Expect = 0.082 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVL 368 +YK +D Q+L KEGA FKG ++L+A G + Sbjct: 261 RYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFM 299
>DNC_MACFA (Q5IS35) Mitochondrial deoxynucleotide carrier (Solute carrier| family 25 member 19) Length = 320 Score = 35.4 bits (80), Expect = 0.082 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVL 368 +YK +D Q+L KEGA FKG ++L+A G + Sbjct: 261 RYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFM 299
>DNC_HUMAN (Q9HC21) Mitochondrial deoxynucleotide carrier (Solute carrier| family 25 member 19) (Mitochondrial uncoupling protein 1) Length = 320 Score = 35.4 bits (80), Expect = 0.082 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVL 368 +YK +D Q+L KEGA FKG ++L+A G + Sbjct: 261 RYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFM 299
>UCP3_BOVIN (O77792) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 311 Score = 34.7 bits (78), Expect = 0.14 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR-AIAGAGVLSGYD 356 KY ++DA+ I +EG + L+KG NI R AI G + YD Sbjct: 157 KYSGTMDAYRTIAREEGVRGLWKGILPNITRNAIVNCGEMVTYD 200
>UCP2_CANFA (Q9N2J1) Mitochondrial uncoupling protein 2 (UCP 2)| Length = 309 Score = 34.7 bits (78), Expect = 0.14 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR-AIAGAGVLSGYDQLQ 347 +Y+S++DA+ I +EG + L+KG N+ R AI L YD ++ Sbjct: 155 RYQSTVDAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLIK 201
>UCP2_CYPCA (Q9W725) Mitochondrial uncoupling protein 2 (UCP 2)| Length = 310 Score = 34.7 bits (78), Expect = 0.14 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR-AIAGAGVLSGYDQLQ 347 +Y ++DA+ I +EG + L+KG G NI R AI L YD ++ Sbjct: 156 RYHGTMDAYRTIAKEEGFRGLWKGTGPNITRNAIVNCTELVTYDLIK 202
>CMC1_HUMAN (O75746) Calcium-binding mitochondrial carrier protein Aralar1| (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12) Length = 678 Score = 34.7 bits (78), Expect = 0.14 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGV-LSGYDQLQILFF 335 Y +D F +IL +EG + +KG A + R+ GV L+ Y+ LQ F+ Sbjct: 557 YSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTLAHYEVLQRWFY 606
>AGC1_ASHGO (Q75AH6) Mitochondrial aspartate-glutamate transporter AGC1| (Aspartate-glutamate carrier 1) Length = 911 Score = 34.7 bits (78), Expect = 0.14 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAG-VLSGYDQLQILFFGKKY 323 Y DA IL +EG KS FKG A +LR+ G L+ Y+ LF +Y Sbjct: 758 YNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIFHNLFPAPRY 811 Score = 33.9 bits (76), Expect = 0.24 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANIL 395 KYK+S+D +IL+KEG + L+ G G ++ Sbjct: 559 KYKNSIDCLLKILSKEGVRGLYSGLGPQLI 588
>CMC1_DROME (Q9VA73) Calcium-binding mitochondrial carrier Aralar1| Length = 695 Score = 34.3 bits (77), Expect = 0.18 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGV-LSGYDQLQILFF 335 Y DA +I+A+EG ++ +KG A + R+ GV L Y+ LQ LF+ Sbjct: 572 YTGVWDATKKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQRLFY 621
>UCP3_HUMAN (P55916) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 312 Score = 34.3 bits (77), Expect = 0.18 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR-AIAGAGVLSGYDQLQ 347 KY ++DA+ I +EG + L+KG NI+R AI + YD L+ Sbjct: 158 KYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILK 204
>UCP3_RAT (P56499) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 308 Score = 34.3 bits (77), Expect = 0.18 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR-AIAGAGVLSGYD 356 KY+ ++DA+ I +EG + L+KG NI R AI + YD Sbjct: 154 KYRGTMDAYRTIAREEGVRGLWKGTWPNITRNAIVNCAEMVTYD 197
>UCP3_MOUSE (P56501) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 308 Score = 34.3 bits (77), Expect = 0.18 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR-AIAGAGVLSGYD 356 KY+ ++DA+ I +EG + L+KG NI R AI + YD Sbjct: 154 KYRGTMDAYRTIAREEGVRGLWKGTWPNITRNAIVNCAEMVTYD 197
>CMC2_MACFA (Q8HXW2) Calcium-binding mitochondrial carrier protein Aralar2| (Mitochondrial aspartate glutamate carrier 2) (Solute carrier family 25 member 13) (Citrin) Length = 674 Score = 33.9 bits (76), Expect = 0.24 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGV-LSGYDQLQILFF 335 Y +D F +IL +EG K+L+KGA A + R+ GV L Y+ LQ F+ Sbjct: 559 YSGVIDCFKKILREEGPKALWKGA-ARVFRSSPQFGVTLLTYELLQRWFY 607
>UCP2_MOUSE (P70406) Mitochondrial uncoupling protein 2 (UCP 2) (UCPH)| Length = 309 Score = 33.5 bits (75), Expect = 0.31 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR-AIAGAGVLSGYDQLQ 347 +Y+S+++A+ I +EG + L+KG N+ R AI L YD ++ Sbjct: 155 RYQSTVEAYKTIAREEGIRGLWKGTSPNVARNAIVNCAELVTYDLIK 201
>CMC1_PONPY (Q5RBC8) Calcium-binding mitochondrial carrier protein Aralar1| (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12) Length = 678 Score = 33.5 bits (75), Expect = 0.31 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGV-LSGYDQLQILFF 335 Y +D F +IL +EG + +KG A + R+ GV L Y+ LQ F+ Sbjct: 557 YSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYELLQRWFY 606
>YEA6_YEAST (P39953) Putative mitochondrial carrier YEL006W| Length = 335 Score = 33.5 bits (75), Expect = 0.31 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILF 338 YK ++D F +I+ +EGAK+L+ G +L + A Y+ L+I F Sbjct: 179 YKGTIDTFRKIIQQEGAKALYAGLVPALLGMLNVAIQFPLYENLKIRF 226
>CMC1_MOUSE (Q8BH59) Calcium-binding mitochondrial carrier protein Aralar1| (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12) Length = 677 Score = 33.1 bits (74), Expect = 0.41 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGV-LSGYDQLQILFF 335 Y +D F +IL +EG + +KG A + R+ GV L Y+ LQ F+ Sbjct: 557 YSGVVDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYELLQRWFY 606
>UCP3_CANFA (Q9N2I9) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 311 Score = 32.7 bits (73), Expect = 0.53 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR-AIAGAGVLSGYD 356 KY ++DA+ I +EG + L+KG NI R AI + YD Sbjct: 157 KYSGTMDAYRTIAREEGVRGLWKGTLPNITRNAIVNCAEMVTYD 200
>UCP3_PIG (O97649) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 308 Score = 32.7 bits (73), Expect = 0.53 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR-AIAGAGVLSGYDQLQ 347 KY ++DA+ I +EG + L+KG NI R AI + YD ++ Sbjct: 154 KYSGTMDAYRTIAREEGVRGLWKGILPNITRNAIVNCAEMVTYDVIK 200
>UCP2_RAT (P56500) Mitochondrial uncoupling protein 2 (UCP 2)| Length = 309 Score = 32.7 bits (73), Expect = 0.53 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR-AIAGAGVLSGYDQLQ 347 +Y+S+++A+ I +EG + L+KG N+ R AI L YD ++ Sbjct: 155 RYQSTVEAYKTIAREEGIRGLWKGTSPNVARNAIVNCTELVTYDLIK 201
>UCP2_HUMAN (P55851) Mitochondrial uncoupling protein 2 (UCP 2) (UCPH)| Length = 309 Score = 32.7 bits (73), Expect = 0.53 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR-AIAGAGVLSGYDQLQ 347 +Y+S+++A+ I +EG + L+KG N+ R AI L YD ++ Sbjct: 155 RYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLIK 201
>TXTP_YEAST (P38152) Tricarboxylate transport protein (Citrate transport| protein) (CTP) Length = 299 Score = 32.0 bits (71), Expect = 0.91 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVL 368 + KY S+++ F I +EG K+ +KGA + R + G++ Sbjct: 247 STKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIV 287
>AGC1_YEAST (Q12482) Mitochondrial aspartate-glutamate transporter AGC1| (Aspartate-glutamate carrier 1) Length = 902 Score = 31.6 bits (70), Expect = 1.2 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAG-VLSGYD 356 KY A IL +E +S FKG GA +LR+ G L+ Y+ Sbjct: 765 KYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYE 808 Score = 31.2 bits (69), Expect = 1.6 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANIL 395 +YK+S+D +I+++EG K L+ G G ++ Sbjct: 566 QYKNSIDCLLKIISREGIKGLYSGLGPQLI 595
>DNC_MOUSE (Q9DAM5) Mitochondrial deoxynucleotide carrier (Solute carrier| family 25 member 19) Length = 318 Score = 31.6 bits (70), Expect = 1.2 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVL 368 Y+ LD Q+L +EG + FKG ++++A G + Sbjct: 262 YRGLLDLTQQVLQEEGTRGFFKGLSPSLMKAALSTGFM 299
>BT1_MAIZE (P29518) Protein brittle-1, chloroplast precursor| Length = 436 Score = 31.2 bits (69), Expect = 1.6 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGV 371 Y++ L A IL KEGA L++G G + ++ + AG+ Sbjct: 365 YQNVLHAIYCILKKEGAGGLYRGLGPSCIKLMPAAGI 401
>ANT1_ASHGO (Q75A82) Peroxisomal adenine nucleotide transporter 1| Length = 340 Score = 31.2 bits (69), Expect = 1.6 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRA-IAGAGVLSGYDQLQILFFGKKYGSG 314 A +YK +LDA +I EG L++G G++ + I Y ++ +F K G Sbjct: 69 AEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQARG 128 Query: 313 GA*RGRNDDE 284 G R +E Sbjct: 129 GDARFSTPEE 138
>RIM2_YEAST (P38127) Mitochondrial carrier protein RIM2| Length = 377 Score = 31.2 bits (69), Expect = 1.6 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQIL 341 +YK+S D ++ EG L+KG A+ L ++ G Y+Q++ L Sbjct: 215 QYKNSWDCLKSVIRNEGFTGLYKGLSASYLGSVEGILQWLLYEQMKRL 262 Score = 29.6 bits (65), Expect = 4.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGV 371 +K +L + +EG +SLFKG G N++ I + Sbjct: 116 FKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSI 152
>CMC1_CAEEL (Q21153) Probable calcium-binding mitochondrial carrier K02F3.2| Length = 707 Score = 31.2 bits (69), Expect = 1.6 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGV-LSGYDQLQILFFGKKYGS 317 Y +D +++ +EG SL+KG A + R+ V L Y+ LQ LF+ GS Sbjct: 600 YNGVIDCARKLIKEEGPMSLWKGTAARVCRSSPQFAVTLLTYEVLQRLFYVDFAGS 655
>DNJH_CUCSA (Q04960) DnaJ protein homolog (DNAJ-1)| Length = 413 Score = 30.8 bits (68), Expect = 2.0 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILR-AIAGAGVLSGYDQLQILFFGKKYGSGGA 308 K+K A+ ++L+ + ++ G + L+ + G G +D Q F G +G GG+ Sbjct: 49 KFKELAQAY-EVLSDPEKREIYDQYGEDALKEGMGGGGGHDPFDIFQSFFGGSPFGGGGS 107 Query: 307 *RGRNDDEQE 278 RGR E Sbjct: 108 SRGRRQRRGE 117
>DIC_HUMAN (Q9UBX3) Mitochondrial dicarboxylate carrier (Solute carrier family| 25 member 10) Length = 287 Score = 30.8 bits (68), Expect = 2.0 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAG-ANILRAIAGAGVLSGYDQLQILFFGKKY 323 Y +LD ++ +EG + LF GA A+ A+ G LS YDQ + L Y Sbjct: 141 YAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGY 194
>ODC1_YEAST (Q03028) Mitochondrial 2-oxodicarboxylate carrier 1| Length = 310 Score = 30.4 bits (67), Expect = 2.7 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -1 Query: 484 KYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVL 368 KY SL + + +EG K+L+KG ++R G G+L Sbjct: 252 KYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLL 290
>TXTP_CAEEL (P34519) Putative tricarboxylate transport protein, mitochondrial| precursor (Citrate transport protein) (CTP) Length = 312 Score = 30.0 bits (66), Expect = 3.5 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGV 371 A KYK++LD QI KEG + +KG + R G+ Sbjct: 253 AKKYKNTLDCAMQIWKKEGFFAFYKGTVPRLSRVCLDVGI 292
>ODC_MOUSE (Q8BZ09) Mitochondrial 2-oxodicarboxylate carrier (Solute carrier| family 25 member 21) Length = 298 Score = 30.0 bits (66), Expect = 3.5 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVL 368 +KY+S I +EG +L+KG ++R G GV+ Sbjct: 244 IKYRSCFKTMEMIYREEGILALYKGLVPKVMRLGPGGGVM 283
>YMC2_YEAST (P38087) Carrier protein YMC2, mitochondrial precursor| Length = 329 Score = 30.0 bits (66), Expect = 3.5 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -1 Query: 484 KYKSSLD-AFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKK 326 KYK+S+ I AKEG ++ FKG G ++R+ G +L + F G++ Sbjct: 276 KYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMRFLGEE 329
>POLG_RTSVT (Q91PP5) Genome polyprotein [Contains: Putative leader protein;| Coat protein 1 (25 kDa protein) (CP-1); Coat protein 2 (26 kDa protein) (CP-2); Coat protein 3 (35 kDa protein) (CP-3); Putative helicase (EC 3.6.1.-) (Putative NTP-binding protei Length = 3471 Score = 29.6 bits (65), Expect = 4.5 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 152 GVRCLHQKRMLGKSTLYRNYC 214 GVRC HQ + GK+ ++ NYC Sbjct: 24 GVRCAHQGWVSGKAVVFCNYC 44
>POLG_RTSVA (Q83034) Genome polyprotein [Contains: Putative leader protein;| Coat protein 1 (25 kDa protein) (CP-1); Coat protein 2 (26 kDa protein) (CP-2); Coat protein 3 (35 kDa protein) (CP-3); Putative helicase (EC 3.6.1.-) (Putative NTP-binding protei Length = 3473 Score = 29.6 bits (65), Expect = 4.5 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 152 GVRCLHQKRMLGKSTLYRNYC 214 GVRC HQ + GK+ ++ NYC Sbjct: 24 GVRCAHQGWVSGKAVVFCNYC 44
>ABR18_PEA (Q06930) ABA-responsive protein ABR18| Length = 158 Score = 29.6 bits (65), Expect = 4.5 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 136 TYDN-LWSSMPPPKTNVGKIHPLQKLLPSNVKKIKVRQILEG 258 TY+N S++PP K +H ++P V IK +ILEG Sbjct: 5 TYENDTTSTVPPAKLFKAVVHDADLIVPKVVDSIKTVEILEG 46
>YIA6_YEAST (P40556) Putative mitochondrial carrier YIL006W| Length = 373 Score = 29.6 bits (65), Expect = 4.5 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILF 338 YK + DAF ++ +EG K+L+ G ++L A Y+ L++ F Sbjct: 217 YKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFHVAIHFPIYEDLKVRF 264
>DNJH2_ALLPO (P42824) DnaJ protein homolog 2| Length = 418 Score = 29.3 bits (64), Expect = 5.9 Identities = 20/62 (32%), Positives = 27/62 (43%) Frame = -1 Query: 454 QILAKEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA*RGRNDDEQEK 275 +I + G + L +G G G GV +D Q F G +G GG+ RGR E Sbjct: 68 EIYDQYGEEGLKEGMGG-------GGGVHDPFDIFQSFFGGGGFGGGGSSRGRRQRRGED 120 Query: 274 SV 269 V Sbjct: 121 VV 122
>TXTP_RAT (P32089) Tricarboxylate transport protein, mitochondrial precursor| (Citrate transport protein) (CTP) (Tricarboxylate carrier protein) (Solute carrier family 25 member 1) Length = 311 Score = 28.9 bits (63), Expect = 7.7 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKG 413 A KY+++LD QIL EG K+ +KG Sbjct: 253 AHKYRNTLDCGVQILKNEGPKAFYKG 278
>TXTP_BOVIN (P79110) Tricarboxylate transport protein, mitochondrial precursor| (Citrate transport protein) (CTP) (Tricarboxylate carrier protein) (Solute carrier family 25 member 1) Length = 311 Score = 28.9 bits (63), Expect = 7.7 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -1 Query: 490 AVKYKSSLDAFNQILAKEGAKSLFKG 413 A KY+++LD QIL EG K+ +KG Sbjct: 253 AHKYRNTLDCGLQILRNEGLKAFYKG 278
>MURG_RICTY (Q68WW7) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 385 Score = 28.9 bits (63), Expect = 7.7 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 6/43 (13%) Frame = -3 Query: 275 VCSQSCPSRIWRTFI------FLTLEGNNFCRGWIFPTFVFGG 165 + SQ CP+++ +T + F+ N F IF F+FGG Sbjct: 172 LASQHCPTKLTKTVLTNTLNHFVKARNNKFSNCNIFTLFIFGG 214
>DNAJ_FRATT (Q5NFG8) Chaperone protein dnaJ| Length = 374 Score = 28.9 bits (63), Expect = 7.7 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = -1 Query: 487 VKYKSSLDAFNQILAKEGAKSL---FKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGS 317 +K+K +A+ +IL+ + +S F AG N G G G++ + FFG Sbjct: 45 IKFKEISEAY-EILSDDSKRSRYDQFGHAGVNQQSGFGGTGGFGGFEDIFDTFFG----- 98 Query: 316 GGA*RGRN 293 GG RG N Sbjct: 99 GGTSRGSN 106
>PM34_HUMAN (O43808) Peroxisomal membrane protein PMP34 (34 kDa peroxisomal| membrane protein) (Solute carrier family 25 member 17) Length = 307 Score = 28.9 bits (63), Expect = 7.7 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 481 YKSSLDAFNQILAKEGAKSLFKGAGANIL 395 YK +DAF+QI+ EG +L+ G ++L Sbjct: 146 YKGIIDAFHQIIRDEGISALWNGTFPSLL 174
>GUAA_DEHSC (Q3ZXH7) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 533 Score = 28.9 bits (63), Expect = 7.7 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +2 Query: 2 DKLDLI*VGFEDNVFKENCPVTIQGTYSN 88 D+++ + GF+ + ENCPV + G S+ Sbjct: 154 DRIEKLPAGFKSLAYTENCPVAVMGNESD 182 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,073,884 Number of Sequences: 219361 Number of extensions: 1393243 Number of successful extensions: 4234 Number of sequences better than 10.0: 84 Number of HSP's better than 10.0 without gapping: 4075 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4233 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
