| Clone Name | rbags26a05 |
|---|---|
| Clone Library Name | barley_pub |
>KR106_HUMAN (P60371) Keratin-associated protein 10-6 (Keratin-associated| protein 10.6) (High sulfur keratin-associated protein 10.6) (Keratin-associated protein 18-6) (Keratin-associated protein 18.6) Length = 365 Score = 33.9 bits (76), Expect = 0.32 Identities = 26/66 (39%), Positives = 30/66 (45%) Frame = +2 Query: 344 STVQLLLHPDRLPTRFDLVLDLGQRAISSS*MGCCQGCFSVSLLCIPLLERNASAVEICQ 523 S+V LL HP T V G A SS CC+ VSLLC P+ R A +C Sbjct: 302 SSVSLLCHPVCKSTCCVPVPSCGASA-SSCQPSCCRTASCVSLLCRPMCSRPA-CYSLCS 359 Query: 524 GQGLLC 541 GQ C Sbjct: 360 GQKSSC 365
>KR10A_HUMAN (P60014) Keratin-associated protein 10-10 (Keratin-associated| protein 10.10) (High sulfur keratin-associated protein 10.10) (Keratin-associated protein 18-10) (Keratin-associated protein 18.10) Length = 251 Score = 33.5 bits (75), Expect = 0.42 Identities = 26/66 (39%), Positives = 30/66 (45%) Frame = +2 Query: 344 STVQLLLHPDRLPTRFDLVLDLGQRAISSS*MGCCQGCFSVSLLCIPLLERNASAVEICQ 523 S+V LL HP T V G A SS CC+ VSLLC P+ R A +C Sbjct: 188 SSVSLLCHPVCKSTCCVPVPSCGASA-SSCQPSCCRTASCVSLLCRPVCSRPA-CYSLCS 245 Query: 524 GQGLLC 541 GQ C Sbjct: 246 GQKSSC 251
>IF16_HUMAN (Q16666) Gamma-interferon-inducible protein Ifi-16| (Interferon-inducible myeloid differentiation transcriptional activator) (IFI 16) Length = 785 Score = 31.2 bits (69), Expect = 2.1 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -2 Query: 524 LGKFLPQKHSSPAVEYKEVKPKNTPDNNPFKKRKLPSDQGQVP 396 + K + + HS + ++K K P NN K KLP +Q Q+P Sbjct: 375 MSKLISEMHS-----FIQIKKKTNPRNNDPKSMKLPQEQRQLP 412
>NOC2L_ARATH (Q9ZPV5) Nucleolar complex protein 2 homolog (NOC2 protein homolog)| Length = 779 Score = 31.2 bits (69), Expect = 2.1 Identities = 13/58 (22%), Positives = 29/58 (50%) Frame = -2 Query: 335 SRESVDPAESLERNGVSAGLCWPLTQESVASIPNERSSKRQSQQKAFRNKTNKNKDER 162 S + D + +E+ + W +S P E +K++ +++ ++KT K +DE+ Sbjct: 650 SSDDEDDEDRMEKGAAAFNSSWLPGSDSKEKEPEEEKTKKKKRKRGGKSKTEKKQDEQ 707
>PHF13_MOUSE (Q8K2W6) PHD finger protein 13| Length = 296 Score = 31.2 bits (69), Expect = 2.1 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = -2 Query: 338 LSRESVDPAESLERNGVSAGLCWPLTQESVASIPNE--RSSKRQSQQKAFRNKTNKNKDE 165 + + S DP + + S+G C ++ + V I E R+ RQ +Q FR++ + DE Sbjct: 156 IPQASADPCSGWDSDTPSSGSCATVSPDQVTEIKTEGKRTIVRQGKQVVFRDEDSTGNDE 215
>Y687_MYCPN (Q50315) Protein MPN687 (K05_orf250)| Length = 250 Score = 30.8 bits (68), Expect = 2.7 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -2 Query: 512 LPQKHSSPAVEYKEVKPKNTPDNNPFKKRKLPSDQGQVP 396 +PQ PAVE +VK P N ++ LP + +VP Sbjct: 160 VPQPEPQPAVEQPQVKQTTRPSNKLQEEENLPPPKAKVP 198
>AKAP2_MOUSE (O54931) A-kinase anchor protein 2 (Protein kinase A-anchoring| protein 2) (PRKA2) (AKAP-2) (AKAP expressed in kidney and lung) (AKAP-KL) Length = 885 Score = 30.0 bits (66), Expect = 4.6 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -2 Query: 521 GKFLPQKHSSPAVEYKEVKPKNTPDNNPFKKRKLPS 414 G F P + SSP E +++ PKN P + + K PS Sbjct: 642 GMFAPPQVSSPVQEKRDILPKNLPAEDRALREKGPS 677
>KR104_HUMAN (P60372) Keratin-associated protein 10-4 (Keratin-associated| protein 10.4) (High sulfur keratin-associated protein 10.4) (Keratin-associated protein 18-4) (Keratin-associated protein 18.4) Length = 401 Score = 29.3 bits (64), Expect = 7.9 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +2 Query: 425 SSS*MGCCQGCFSVSLLCIPLLERNASAVEICQGQGLLCC 544 SS CC S C+P+ + S V +C G CC Sbjct: 301 SSCQPACCTSSQSQQGCCVPVCCKPVSCVPVCSGASSSCC 340
>FABH2_VIBPA (Q87HJ2) 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2 (EC| 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase III protein 2) (Beta-ketoacyl-ACP synthase III 2) (KAS III 2) Length = 364 Score = 29.3 bits (64), Expect = 7.9 Identities = 21/97 (21%), Positives = 38/97 (39%), Gaps = 11/97 (11%) Frame = -2 Query: 422 LPSDQGQVPNQNXXXXXXXXXXXXLCSSLSRESVDPAESLERNGVSAGLCWPLT------ 261 +P D+ V QN LC ++ + V+P +++ AGL W Sbjct: 267 IPQDKAFVNIQNYGNTSAATVPIALCEAVEQGRVNPGDNMLLAAFGAGLTWGAAVLKWGD 326 Query: 260 -----QESVASIPNERSSKRQSQQKAFRNKTNKNKDE 165 ES A++P S + ++A + + +DE Sbjct: 327 RVTPIGESDAALPECEQSALELLERAIKLCNERRRDE 363 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,439,544 Number of Sequences: 219361 Number of extensions: 1318486 Number of successful extensions: 3715 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3713 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)