| Clone Name | rbags25l02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | US10_HHV11 (P06486) Virion protein US10 | 31 | 2.2 | 2 | LET23_CAEEL (P24348) Receptor tyrosine-protein kinase let-23 pre... | 30 | 4.9 |
|---|
>US10_HHV11 (P06486) Virion protein US10| Length = 312 Score = 31.2 bits (69), Expect = 2.2 Identities = 31/92 (33%), Positives = 41/92 (44%), Gaps = 5/92 (5%) Frame = -3 Query: 452 RNSVHSNIAVPPEXSPQRLHLLEHSGD----XDPGHY-AEHPLLRXLVAEKGDERVAYRR 288 R +H+ + VPP SP HL + GD D G Y + L LV D R A+ R Sbjct: 136 RVGIHTAVRVPPTGSPTHTHLRQDPGDEPTSDDSGLYPLDARALAHLVMLPADHR-AFFR 194 Query: 287 NTSCPGRVERARVRGRHDGL*ESMVGRYQARL 192 R+ A VR +M+GR+ ARL Sbjct: 195 TVVEVSRMCAANVRDPPPPATGAMLGRH-ARL 225
>LET23_CAEEL (P24348) Receptor tyrosine-protein kinase let-23 precursor (EC| 2.7.10.1) (Lethal protein 23) Length = 1367 Score = 30.0 bits (66), Expect = 4.9 Identities = 19/66 (28%), Positives = 27/66 (40%), Gaps = 10/66 (15%) Frame = +3 Query: 255 CTLHPSRT*SIPAICHALITLFGNQXSQEWMFCI----------VSGIXIAGVLK*VQSL 404 C +P SI I +T FGN +Q W C+ +GI G ++ L Sbjct: 44 CMRYPPSIGSILLIIPIFLTFFGNSNAQLWKRCVSPQDCLCSGTTNGISRYGTGNILEDL 103 Query: 405 RTXFRG 422 T +RG Sbjct: 104 ETMYRG 109 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,359,225 Number of Sequences: 219361 Number of extensions: 1411195 Number of successful extensions: 4084 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4083 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4815021120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)