| Clone Name | rbags25k23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SAPK8_ORYSA (Q7Y0B9) Serine/threonine-protein kinase SAPK8 (EC 2... | 35 | 0.070 | 2 | MURD_PSEU2 (Q4ZNY8) UDP-N-acetylmuramoylalanine--D-glutamate lig... | 32 | 0.59 | 3 | MURD_PSESM (Q87WY3) UDP-N-acetylmuramoylalanine--D-glutamate lig... | 30 | 3.8 | 4 | RL10_CLOPE (Q8XHR6) 50S ribosomal protein L10 | 28 | 8.6 | 5 | RF3_SYNY3 (P73473) Peptide chain release factor 3 (RF-3) | 28 | 8.6 |
|---|
>SAPK8_ORYSA (Q7Y0B9) Serine/threonine-protein kinase SAPK8 (EC 2.7.11.1)| (Osmotic stress/abscisic acid-activated protein kinase 8) Length = 371 Score = 35.4 bits (80), Expect = 0.070 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 457 ATIPPACSRINHILT 413 ATIPPACSRINHILT Sbjct: 327 ATIPPACSRINHILT 341
>MURD_PSEU2 (Q4ZNY8) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 448 Score = 32.3 bits (72), Expect = 0.59 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = +1 Query: 220 QNEVLLALLTGYSIRSPFSCFLRSLRR----DSRCRWLTSH 330 Q L AL G+++ PF L SLR + RC+WL H Sbjct: 276 QANALAALALGHAVGLPFDAMLASLREFTGLEHRCQWLREH 316
>MURD_PSESM (Q87WY3) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 448 Score = 29.6 bits (65), Expect = 3.8 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = +1 Query: 220 QNEVLLALLTGYSIRSPFSCFLRSLRR----DSRCRWL 321 Q L AL G+++ PF L SLR + RC+WL Sbjct: 276 QANALAALALGHAVGLPFDAMLSSLREFTGLEHRCQWL 313
>RL10_CLOPE (Q8XHR6) 50S ribosomal protein L10| Length = 169 Score = 28.5 bits (62), Expect = 8.6 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = +1 Query: 181 YNQNRTGDFACETQNEVLLALLTGYSIRSPFSCF 282 YN+ +T A EVLLA L G SI+SP S F Sbjct: 121 YNKEQTEQLAAIPSREVLLAKLLG-SIKSPLSNF 153
>RF3_SYNY3 (P73473) Peptide chain release factor 3 (RF-3)| Length = 547 Score = 28.5 bits (62), Expect = 8.6 Identities = 18/53 (33%), Positives = 29/53 (54%) Frame = +3 Query: 132 TTGTEKMLLQGLTPIILQPEQDGGLRLRNTERSAASSFDRVQHQVTFQLLSTV 290 TT TEK+LL G ++ G ++ R ++RSA S + ++ Q + STV Sbjct: 40 TTLTEKLLLYGGAI-----QEAGAVKARRSQRSATSDWMAMEQQRGISITSTV 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,710,679 Number of Sequences: 219361 Number of extensions: 1106403 Number of successful extensions: 2740 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2740 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)