ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags25j22 |
|---|---|
| Clone Library Name | barley_pub |
>PRS4_ORYSA (P46466) 26S protease regulatory subunit 4 homolog (TAT-binding| protein homolog 2) Length = 448 Score = 78.2 bits (191), Expect = 5e-15 Identities = 40/52 (76%), Positives = 41/52 (78%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 126 EFSGADIKAICTE+GLLALRERRMKVTHADF KEGVPEGLYM Sbjct: 397 EFSGADIKAICTEAGLLALRERRMKVTHADFKKAKEKVMFKKKEGVPEGLYM 448
>PRS4_DROME (P48601) 26S protease regulatory subunit 4 (P26s4)| Length = 439 Score = 67.0 bits (162), Expect = 1e-11 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 126 + SGADIKAICTE+GL+ALRERRMKVT+ DF KEG PEGLY+ Sbjct: 388 DLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL 439
>PRS4_CHICK (Q90732) 26S protease regulatory subunit 4 (P26s4) (Proteasome 26S| subunit ATPase 1) Length = 440 Score = 67.0 bits (162), Expect = 1e-11 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 126 + SGADIKAICTE+GL+ALRERRMKVT+ DF EG PEGLY+ Sbjct: 389 DLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENFLYKKTEGTPEGLYL 440
>PRS4_RAT (P62193) 26S protease regulatory subunit 4 (P26s4) (Proteasome 26S| subunit ATPase 1) Length = 440 Score = 66.6 bits (161), Expect = 2e-11 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 126 + SGADIKAICTE+GL+ALRERRMKVT+ DF +EG PEGLY+ Sbjct: 389 DLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL 440
>PRS4_MOUSE (P62192) 26S protease regulatory subunit 4 (P26s4) (Proteasome 26S| subunit ATPase 1) Length = 440 Score = 66.6 bits (161), Expect = 2e-11 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 126 + SGADIKAICTE+GL+ALRERRMKVT+ DF +EG PEGLY+ Sbjct: 389 DLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL 440
>PRS4_HUMAN (P62191) 26S protease regulatory subunit 4 (P26s4) (Proteasome 26S| subunit ATPase 1) Length = 440 Score = 66.6 bits (161), Expect = 2e-11 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 126 + SGADIKAICTE+GL+ALRERRMKVT+ DF +EG PEGLY+ Sbjct: 389 DLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL 440
>PRS4_CAEEL (O16368) Probable 26S protease regulatory subunit 4| Length = 443 Score = 62.0 bits (149), Expect = 4e-10 Identities = 32/52 (61%), Positives = 36/52 (69%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 126 E SGADIKA+CTE+GLLALRERRM+VT DF KEG PE LY+ Sbjct: 392 ELSGADIKAMCTEAGLLALRERRMRVTMEDFQKSKENVLYRKKEGAPEELYL 443
>PRS4_YEAST (P40327) 26S protease regulatory subunit 4 homolog (TAT-binding| homolog 5) Length = 437 Score = 53.9 bits (128), Expect = 1e-07 Identities = 28/52 (53%), Positives = 34/52 (65%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 126 + SGADI+A+CTE+GLLALRERRM+VT DF E EGLY+ Sbjct: 386 DLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYL 437
>PRS4_SCHPO (P36612) 26S protease regulatory subunit 4 homolog (Protein mts2)| Length = 448 Score = 47.8 bits (112), Expect = 7e-06 Identities = 25/49 (51%), Positives = 30/49 (61%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXXXXXKEGVPEG 135 + SGA+IKAI +E+GLLALRERRM+V DF EG P G Sbjct: 396 DLSGAEIKAIVSEAGLLALRERRMRVVMDDFRQAREKVLKTKDEGGPAG 444
>PSMR_ARCFU (O28303) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 398 Score = 46.2 bits (108), Expect = 2e-05 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGADIKAICTE+G+ A+RE R KVT DF Sbjct: 347 SGADIKAICTEAGMFAIREERAKVTMLDF 375
>PRS8_YEAST (Q01939) 26S protease regulatory subunit 8 homolog (SUG1 protein)| (CIM3 protein) (TAT-binding protein TBY1) Length = 405 Score = 45.4 bits (106), Expect = 4e-05 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGAD+K +CTE+G+ ALRERR+ VT DF Sbjct: 354 SGADVKGVCTEAGMYALRERRIHVTQEDF 382
>PRS8_SCHPO (P41836) 26S protease regulatory subunit 8 homolog (Protein let1)| Length = 403 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 352 SGAELKGVCTEAGMFALRERRVHVTQEDF 380
>PRS8_DROME (O18413) 26S protease regulatory subunit 8| Length = 405 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 354 SGAEVKGVCTEAGMYALRERRVHVTQEDF 382
>PRS8_MANSE (P54814) 26S protease regulatory subunit 8 (18-56 protein)| Length = 402 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 351 SGAEVKGVCTEAGMYALRERRVHVTQEDF 379
>PSMR_METTH (O26824) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 410 Score = 43.9 bits (102), Expect = 1e-04 Identities = 19/29 (65%), Positives = 25/29 (86%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGAD+KAICTE+G+ A+R+ R +VT ADF Sbjct: 357 SGADLKAICTEAGMFAIRDERDEVTMADF 385
>PRS8_RAT (P62198) 26S protease regulatory subunit 8 (Proteasome subunit p45)| (p45/SUG) (Proteasome 26S subunit ATPase 5) (Thyroid hormone receptor-interacting protein 1) (TRIP1) Length = 406 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 355 SGAEVKGVCTEAGMYALRERRVHVTQEDF 383
>PRS8_PIG (P62197) 26S protease regulatory subunit 8 (Proteasome subunit p45)| (p45/SUG) (Proteasome 26S subunit ATPase 5) (TAT-binding protein homolog 10) (TBP10) Length = 406 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 355 SGAEVKGVCTEAGMYALRERRVHVTQEDF 383
>PRS8_MOUSE (P62196) 26S protease regulatory subunit 8 (Proteasome subunit p45)| (p45/SUG) (Proteasome 26S subunit ATPase 5) (mSUG1) Length = 406 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 355 SGAEVKGVCTEAGMYALRERRVHVTQEDF 383
>PRS8_HUMAN (P62195) 26S protease regulatory subunit 8 (Proteasome subunit p45)| (p45/SUG) (Proteasome 26S subunit ATPase 5) (Thyroid hormone receptor-interacting protein 1) (TRIP1) Length = 406 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 355 SGAEVKGVCTEAGMYALRERRVHVTQEDF 383
>PRS8_BOVIN (P62194) 26S protease regulatory subunit 8 (Proteasome subunit p45)| (p45/SUG) (Proteasome 26S subunit ATPase 5) Length = 406 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 355 SGAEVKGVCTEAGMYALRERRVHVTQEDF 383
>PRS8_XENLA (P46470) 26S protease regulatory subunit 8 (SUG1 homolog) (xSUG1)| Length = 461 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGA++K +CTE+G+ ALRERR+ VT DF Sbjct: 349 SGAEVKGVCTEAGMYALRERRVHVTQEDF 377
>PRS8_DICDI (P34124) 26S protease regulatory subunit 8 (TAT-binding protein| homolog 10) (Fragment) Length = 389 Score = 43.5 bits (101), Expect = 1e-04 Identities = 18/29 (62%), Positives = 25/29 (86%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGA++KA+CTE+G+ ALRERR+ V+ DF Sbjct: 338 SGAELKAVCTEAGMYALRERRVHVSQEDF 366
>PRS6A_ORYSA (P46465) 26S protease regulatory subunit 6A homolog (TAT-binding| protein homolog 1) (TBP-1) Length = 429 Score = 42.4 bits (98), Expect = 3e-04 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 +F+GA +KA+C E+G+LALR +VTH DF Sbjct: 380 DFNGAQLKAVCVEAGMLALRRDATEVTHEDF 410
>PRS8_NAEFO (Q25544) 26S protease regulatory subunit 8 homolog (TAT-binding| protein homolog) Length = 414 Score = 42.4 bits (98), Expect = 3e-04 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHAD 192 SGA+IKA CTE+G+ ALRERR+ VT D Sbjct: 363 SGAEIKATCTEAGMFALRERRVHVTQED 390
>PRS6A_LYCES (P54776) 26S protease regulatory subunit 6A homolog (TAT-binding| protein homolog 1) (TBP-1) (Mg(2+)-dependent ATPase 1) (LEMA-1) Length = 423 Score = 42.4 bits (98), Expect = 3e-04 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 +F+GA +KA+C E+G+LALR +VTH DF Sbjct: 374 DFNGAQLKAVCVEAGMLALRRDATEVTHEDF 404
>PSMR_METKA (Q8TX03) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 436 Score = 42.0 bits (97), Expect = 4e-04 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGADIKAICTE+G++A+RE R VT DF Sbjct: 385 SGADIKAICTEAGMMAIREDRDIVTMDDF 413
>PSMR_PYRFU (Q8U4H3) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 396 Score = 42.0 bits (97), Expect = 4e-04 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGAD+KAI TE+G+ A+RERR VT DF Sbjct: 342 SGADLKAIATEAGMFAIRERRTYVTQEDF 370
>PSMR_PYRHO (O57940) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 399 Score = 42.0 bits (97), Expect = 4e-04 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGAD+KAI TE+G+ A+RERR VT DF Sbjct: 345 SGADLKAIATEAGMFAIRERRTYVTQEDF 373
>PSMR_PYRAB (Q9V287) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 399 Score = 42.0 bits (97), Expect = 4e-04 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGAD+KAI TE+G+ A+RERR VT DF Sbjct: 345 SGADLKAIATEAGMFAIRERRTYVTQEDF 373
>PSMR2_HALSA (Q9HRW6) Proteasome-activating nucleotidase 2 (Proteasome| regulatory subunit 2) Length = 407 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 + SGAD+KAICTE+G+ A+R+ R +V DF Sbjct: 353 DLSGADVKAICTEAGMFAIRDDRTEVRMQDF 383
>PSMR_PYRKO (Q5JHS5) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 397 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGAD+KAI TE+G+ A+R+RR VT DF Sbjct: 343 SGADLKAIATEAGMFAIRDRRTYVTQDDF 371
>PRS6A_BRACM (O23894) 26S protease regulatory subunit 6A homolog (TAT-binding| protein homolog 1) (TBP-1) Length = 424 Score = 40.4 bits (93), Expect = 0.001 Identities = 16/31 (51%), Positives = 23/31 (74%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 +F+GA +KA+C E+G+LALR +V H DF Sbjct: 375 DFNGAQLKAVCVEAGMLALRRDATEVNHEDF 405
>PRS6A_ARATH (O04019) 26S protease regulatory subunit 6A homolog (TAT-binding| protein homolog 1) (TBP-1) Length = 419 Score = 40.4 bits (93), Expect = 0.001 Identities = 16/31 (51%), Positives = 23/31 (74%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 +F+GA +KA+C E+G+LALR +V H DF Sbjct: 370 DFNGAQLKAVCVEAGMLALRRDATEVNHEDF 400
>PRS7_PRUPE (O64982) 26S protease regulatory subunit 7 (26S proteasome subunit| 7) (26S proteasome AAA-ATPase subunit RPT1) (Regulatory particle triple-A ATPase subunit 1) Length = 425 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/29 (55%), Positives = 23/29 (79%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 +GADI+++CTE+G+ A+R RR VT DF Sbjct: 373 TGADIRSVCTEAGMYAIRARRKTVTEKDF 401
>PRS7_SPIOL (Q41365) 26S protease regulatory subunit 7 (26S proteasome subunit| 7) (26S proteasome AAA-ATPase subunit RPT1) (Regulatory particle triple-A ATPase subunit 1) Length = 426 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/29 (55%), Positives = 23/29 (79%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 +GADI+++CTE+G+ A+R RR VT DF Sbjct: 374 TGADIRSVCTEAGMYAIRARRKTVTEKDF 402
>PRS7_ORYSA (Q9FXT9) 26S protease regulatory subunit 7 (26S proteasome subunit| 7) (26S proteasome AAA-ATPase subunit RPT1) (Regulatory particle triple-A ATPase subunit 1) Length = 426 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/29 (55%), Positives = 23/29 (79%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 +GADI+++CTE+G+ A+R RR VT DF Sbjct: 374 TGADIRSVCTEAGMYAIRARRKTVTEKDF 402
>PRS7_ARATH (Q9SSB5) 26S protease regulatory subunit 7 (26S proteasome subunit| 7) (26S proteasome AAA-ATPase subunit RPT1a) (Regulatory particle triple-A ATPase subunit 1a) Length = 426 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/29 (55%), Positives = 23/29 (79%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 +GADI+++CTE+G+ A+R RR VT DF Sbjct: 374 TGADIRSVCTEAGMYAIRARRKTVTEKDF 402
>PRS6B_RAT (Q63570) 26S protease regulatory subunit 6B (TAT-binding protein 7)| (TBP-7) Length = 418 Score = 38.1 bits (87), Expect = 0.006 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 + SGADI +IC ESG+LA+RE R V DF Sbjct: 369 KISGADINSICQESGMLAVRENRYIVLAKDF 399
>PRS6B_HUMAN (P43686) 26S protease regulatory subunit 6B (MIP224)| (MB67-interacting protein) (TAT-binding protein 7) (TBP-7) Length = 418 Score = 38.1 bits (87), Expect = 0.006 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 + SGADI +IC ESG+LA+RE R V DF Sbjct: 369 KISGADINSICQESGMLAVRENRYIVLAKDF 399
>PR6AB_XENLA (O42586) 26S protease regulatory subunit 6A-B (TAT-binding protein| 10) (TBP-10) Length = 404 Score = 38.1 bits (87), Expect = 0.006 Identities = 14/31 (45%), Positives = 23/31 (74%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 +F+GA KA+C E+G++ALR ++TH D+ Sbjct: 355 DFNGAQCKAVCVEAGIIALRRGATELTHEDY 385
>PRS6A_RAT (Q63569) 26S protease regulatory subunit 6A (TAT-binding protein 1)| (TBP-1) (Spermatogenic cell/sperm-associated TAT-binding protein homolog SATA) Length = 439 Score = 38.1 bits (87), Expect = 0.006 Identities = 14/31 (45%), Positives = 23/31 (74%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 +F+GA KA+C E+G++ALR ++TH D+ Sbjct: 390 DFNGAQCKAVCVEAGMIALRRGATELTHEDY 420
>PRS6A_HUMAN (P17980) 26S protease regulatory subunit 6A (TAT-binding protein 1)| (TBP-1) (Proteasome subunit P50) Length = 439 Score = 38.1 bits (87), Expect = 0.006 Identities = 14/31 (45%), Positives = 23/31 (74%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 +F+GA KA+C E+G++ALR ++TH D+ Sbjct: 390 DFNGAQCKAVCVEAGMIALRRGATELTHEDY 420
>PRS7_CAEEL (Q18787) Probable 26S protease regulatory subunit 7| Length = 435 Score = 37.0 bits (84), Expect = 0.013 Identities = 14/29 (48%), Positives = 22/29 (75%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 +GA+I+++CTE+G+ A+R RR T DF Sbjct: 383 TGAEIRSVCTEAGMFAIRARRKVATEKDF 411
>PRS6A_YEAST (P33297) 26S protease regulatory subunit 6A (TAT-binding protein| homolog 1) (TBP-1) Length = 434 Score = 37.0 bits (84), Expect = 0.013 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 EF+GA +KA+ E+G++ALR + V H DF Sbjct: 385 EFNGAQLKAVTVEAGMIALRNGQSSVKHEDF 415
>PSMR_METMP (Q6LWR0) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 407 Score = 37.0 bits (84), Expect = 0.013 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -3 Query: 272 GADIKAICTESGLLALRERRMKVTHADF 189 GAD+KA+CTE+G+ A+RE R + DF Sbjct: 354 GADLKAVCTEAGMFAIREEREFIKMDDF 381
>PRS7_XENLA (P46472) 26S protease regulatory subunit 7 (MSS1 protein)| Length = 433 Score = 37.0 bits (84), Expect = 0.013 Identities = 14/29 (48%), Positives = 22/29 (75%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 +GA+I+++CTE+G+ A+R RR T DF Sbjct: 381 TGAEIRSVCTEAGMFAIRARRKVATEKDF 409
>PRS6A_MOUSE (O88685) 26S protease regulatory subunit 6A (TAT-binding protein 1)| (TBP-1) Length = 442 Score = 36.6 bits (83), Expect = 0.017 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHAD 192 +F+GA KA+C E+G++ALR ++TH D Sbjct: 393 DFNGAQSKAVCVEAGMIALRRGATELTHED 422
>PSMR_METJA (Q58576) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 430 Score = 36.6 bits (83), Expect = 0.017 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -3 Query: 272 GADIKAICTESGLLALRERRMKVTHADF 189 GA++KAICTE+G+ A+RE R VT DF Sbjct: 377 GAELKAICTEAGMNAIRELRDYVTMDDF 404
>PRS7_RAT (Q63347) 26S protease regulatory subunit 7 (MSS1 protein)| Length = 432 Score = 36.6 bits (83), Expect = 0.017 Identities = 14/29 (48%), Positives = 22/29 (75%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 +GA+I+++CTE+G+ A+R RR T DF Sbjct: 380 TGAEIRSVCTEAGMFAIRARRKIATEKDF 408
>PRS7_MOUSE (P46471) 26S protease regulatory subunit 7 (MSS1 protein)| Length = 432 Score = 36.6 bits (83), Expect = 0.017 Identities = 14/29 (48%), Positives = 22/29 (75%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 +GA+I+++CTE+G+ A+R RR T DF Sbjct: 380 TGAEIRSVCTEAGMFAIRARRKIATEKDF 408
>PRS7_HUMAN (P35998) 26S protease regulatory subunit 7 (MSS1 protein)| Length = 432 Score = 36.6 bits (83), Expect = 0.017 Identities = 14/29 (48%), Positives = 22/29 (75%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 +GA+I+++CTE+G+ A+R RR T DF Sbjct: 380 TGAEIRSVCTEAGMFAIRARRKIATEKDF 408
>PSMR_SULSO (Q980M1) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 393 Score = 36.2 bits (82), Expect = 0.022 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRERRMKVTHAD 192 FSGADIK +C E+ +A+R+ R KVT D Sbjct: 339 FSGADIKNVCVEAAYMAIRDGRNKVTMND 367
>PRS7_SCHPO (O42931) 26S protease regulatory subunit 7 homolog| Length = 438 Score = 36.2 bits (82), Expect = 0.022 Identities = 13/29 (44%), Positives = 22/29 (75%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 +GA+++++CTE+G+ A+R RR T DF Sbjct: 385 TGAELRSVCTEAGMFAIRARRRVATEKDF 413
>PRS6A_SCHPO (O14126) 26S protease regulatory subunit 6A| Length = 438 Score = 36.2 bits (82), Expect = 0.022 Identities = 13/31 (41%), Positives = 23/31 (74%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 E++GA +K++C E+G++ALR+ K+ H F Sbjct: 389 EYNGAMLKSVCVEAGMIALRQGDTKINHEHF 419
>PRS7_YEAST (P33299) 26S protease regulatory subunit 7 homolog (CIM5 protein)| (TAT-binding homolog 3) Length = 467 Score = 36.2 bits (82), Expect = 0.022 Identities = 13/29 (44%), Positives = 22/29 (75%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 +GA+++++CTE+G+ A+R RR T DF Sbjct: 415 TGAELRSVCTEAGMFAIRARRKVATEKDF 443
>PRS6B_MANSE (P46507) 26S protease regulatory subunit 6B (ATPase MS73)| Length = 415 Score = 35.0 bits (79), Expect = 0.049 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGADI AIC E+G+ A+RE R V DF Sbjct: 368 SGADINAICQEAGMNAVRENRYIVLPKDF 396
>PRS6B_ENCCU (Q8SQI9) 26S protease regulatory subunit 6B homolog| Length = 387 Score = 34.7 bits (78), Expect = 0.065 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 + S ADI +IC E+G+LA+R R VT DF Sbjct: 338 KISCADINSICQEAGMLAVRASRYMVTQRDF 368
>PSMR_SULTO (Q975U2) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 392 Score = 34.7 bits (78), Expect = 0.065 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRERRMKVTHAD 192 FSGA+IK +CTE+G +A+R R V D Sbjct: 339 FSGAEIKNVCTEAGYIAIRNGRKYVNMTD 367
>Y1297_ARCFU (O28972) Cell division cycle protein 48 homolog AF1297| Length = 733 Score = 34.3 bits (77), Expect = 0.084 Identities = 13/20 (65%), Positives = 19/20 (95%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRE 219 +SGADI+A+C E+G+LA+RE Sbjct: 658 YSGADIEAVCREAGMLAIRE 677
>PRS10_CAEEL (O17071) Probable 26S protease regulatory subunit S10B (Proteasome| regulatory particle ATPase-like protein 4) Length = 406 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRERRMKVTHADF 189 FS AD++ +CTE+G+ A+R R V DF Sbjct: 355 FSAADLRNVCTEAGMFAIRAEREFVIDEDF 384
>PSMR1_HALSA (Q9HNP9) Proteasome-activating nucleotidase 1 (Proteasome| regulatory subunit 1) Length = 411 Score = 33.5 bits (75), Expect = 0.14 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 EFSGA + ++ TE+G+ A+R+ R +V DF Sbjct: 356 EFSGAQLASLATEAGMFAIRDDRDEVHRQDF 386
>PSMR_METAC (Q8TI88) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 421 Score = 33.1 bits (74), Expect = 0.19 Identities = 15/29 (51%), Positives = 21/29 (72%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGAD+KAI TE+G+ A+R+ + V DF Sbjct: 365 SGADLKAIATEAGMFAVRKDKALVEMEDF 393
>PRS10_SPETR (P62335) 26S protease regulatory subunit S10B (Proteasome subunit| p42) (Proteasome 26S subunit ATPase 6) (Conserved ATPase domain protein 44) (CADp44) Length = 389 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRERRMKVTHADF 189 F+GAD++ +CTE+G+ A+R V DF Sbjct: 338 FNGADLRNVCTEAGMFAIRADHDFVVQEDF 367
>PRS10_MOUSE (P62334) 26S protease regulatory subunit S10B (Proteasome subunit| p42) (Proteasome 26S subunit ATPase 6) Length = 389 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRERRMKVTHADF 189 F+GAD++ +CTE+G+ A+R V DF Sbjct: 338 FNGADLRNVCTEAGMFAIRADHDFVVQEDF 367
>PRS10_HUMAN (P62333) 26S protease regulatory subunit S10B (Proteasome subunit| p42) (Proteasome 26S subunit ATPase 6) Length = 389 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRERRMKVTHADF 189 F+GAD++ +CTE+G+ A+R V DF Sbjct: 338 FNGADLRNVCTEAGMFAIRADHDFVVQEDF 367
>PRS6B_CAEEL (P46502) Probable 26S protease regulatory subunit 6B| Length = 414 Score = 32.7 bits (73), Expect = 0.25 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHAD 192 + SGADI +IC E+G+ A+RE R V D Sbjct: 365 KISGADINSICQEAGMQAVRENRYVVLTKD 394
>PRS6B_DICDI (P34123) 26S protease regulatory subunit 6B homolog (TAT-binding| protein homolog 2) Length = 403 Score = 32.0 bits (71), Expect = 0.42 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 + SGA+I++IC E+G+ A+R+ R + DF Sbjct: 354 KLSGAEIQSICQEAGMHAIRKNRYVILPKDF 384
>FTSH3_SYNY3 (P73437) Cell division protein ftsH homolog 3 (EC 3.4.24.-)| Length = 628 Score = 31.6 bits (70), Expect = 0.55 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRERRMKVTHADF 189 F+GAD+ + E+ LLA R ++ VT ADF Sbjct: 380 FAGADLANLVNEAALLAARNKQDSVTEADF 409
>PRS6B_MOUSE (P54775) 26S protease regulatory subunit 6B (MIP224)| (MB67-interacting protein) (TAT-binding protein 7) (TBP-7) (CIP21) Length = 418 Score = 31.2 bits (69), Expect = 0.71 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 + SGADI +IC G+LA+RE V DF Sbjct: 369 KISGADINSICQARGMLAVRETAYIVLAKDF 399
>PSMR_METMA (Q8PY58) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 420 Score = 30.8 bits (68), Expect = 0.93 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHADF 189 SGAD+KAI TE+G+ A+R + V +F Sbjct: 365 SGADLKAIATEAGMFAVRRDKELVEMEEF 393
>ATAD2_PONPY (Q5RDX4) ATPase family AAA domain-containing protein 2| Length = 1091 Score = 30.8 bits (68), Expect = 0.93 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRER 216 + GADIK+IC E+ L ALR R Sbjct: 465 YRGADIKSICAEAALCALRRR 485
>ATAD2_MOUSE (Q8CDM1) ATPase family AAA domain-containing protein 2| Length = 1040 Score = 30.8 bits (68), Expect = 0.93 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRER 216 + GADIK+IC E+ L ALR R Sbjct: 289 YCGADIKSICAEAALCALRRR 309
>ATAD2_HUMAN (Q6PL18) ATPase family AAA domain-containing protein 2| Length = 1390 Score = 30.8 bits (68), Expect = 0.93 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRER 216 + GADIK+IC E+ L ALR R Sbjct: 634 YCGADIKSICAEAALCALRRR 654
>Y1156_METJA (Q58556) Cell division cycle protein 48 homolog MJ1156| Length = 903 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/20 (55%), Positives = 18/20 (90%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRE 219 ++GADI+A+C E+ +LA+RE Sbjct: 655 YTGADIEALCREAAMLAVRE 674
>PRS6B_SOLTU (P54778) 26S protease regulatory subunit 6B homolog| Length = 413 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 + S A+I AIC E+G+ A+R+ R + DF Sbjct: 364 KISAAEITAICQEAGMHAVRKNRYVILPKDF 394
>PRS6B_ARATH (Q9SEI4) 26S protease regulatory subunit 6B homolog (26S proteasome| AAA-ATPase subunit RPT3) (Regulatory particle triple-A ATPase subunit 3) Length = 408 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 281 EFSGADIKAICTESGLLALRERRMKVTHADF 189 + S A+I AIC E+G+ A+R+ R + DF Sbjct: 359 KISAAEIAAICQEAGMHAVRKNRYVILPKDF 389
>SPG7_HUMAN (Q9UQ90) Paraplegin (EC 3.4.24.-) (Spastic paraplegia protein 7)| Length = 795 Score = 28.9 bits (63), Expect = 3.5 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRERRMKVTHADF 189 FSGADI IC E+ L A RE V +F Sbjct: 516 FSGADIANICNEAALHAAREGHTSVHTLNF 545
>MASS1_MOUSE (Q8VHN7) Monogenic audiogenic seizure susceptibility protein 1| precursor (Very large G-protein coupled receptor 1) (Neurepin) Length = 6298 Score = 28.9 bits (63), Expect = 3.5 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +1 Query: 16 QTNLRLSSKPGNISHDTKYIITTQCCSGSEDRCTIH 123 QT L K N++ + +++ C+G + RC IH Sbjct: 5407 QTVTILQEKGANLTDELRFVAGVTTCTGGQTRCFIH 5442
>RCA1_YEAST (P40341) Mitochondrial respiratory chain complexes assembly protein| RCA1 (EC 3.4.24.-) (TAT-binding homolog 12) Length = 825 Score = 28.9 bits (63), Expect = 3.5 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -3 Query: 278 FSGADIKAICTESGLLALR--ERRMKVTH 198 FSGADI +C E+ L+A R E +K+ H Sbjct: 555 FSGADIANVCNEAALIAARSDEDAVKLNH 583
>TBP7_CAEEL (P54816) TAT-binding homolog 7| Length = 1242 Score = 28.5 bits (62), Expect = 4.6 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRER 216 + GAD+K +CTE+ L+ LR R Sbjct: 600 YCGADLKFLCTEAVLIGLRSR 620
>PSMR_AERPE (Q9YAC7) Proteasome-activating nucleotidase (Proteasome regulatory| subunit) Length = 409 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRERRMKVTHAD 192 FSGAD+KA+ E+G A+R +T D Sbjct: 344 FSGADLKAVVVEAGYNAIRRGSRVITMDD 372
>CD48B_ARATH (Q9ZPR1) Cell division control protein 48 homolog B (AtCDC48b)| Length = 603 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRE 219 F+GA+++ +C ESG ++LRE Sbjct: 492 FTGAELEGLCRESGTVSLRE 511
>CD48D_ARATH (Q9SCN8) Putative cell division control protein 48 homolog D| (AtCDC48d) (Transitional endoplasmic reticulum ATPase D) Length = 815 Score = 28.1 bits (61), Expect = 6.0 Identities = 21/85 (24%), Positives = 37/85 (43%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM**IVHRSSL 99 + GAD+ A+CTE+ L +RE K+ D V + + + + Sbjct: 410 YVGADLAALCTEAALQCIRE---KMDVIDLDDEEIDAEILNSMAVSNDHFQTALGNSNPS 466 Query: 98 PEQHCVVIIYLVSWDIFPGLEDRRK 24 + VV + VSW+ GLE+ ++ Sbjct: 467 ALRETVVEVPNVSWEDIGGLENVKR 491
>PRS10_SCHPO (O74445) Probable 26S protease subunit rpt4| Length = 388 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = -3 Query: 275 SGADIKAICTESGLLALRERRMKVTHAD 192 +GAD++ + TE+G +A++E R V +D Sbjct: 338 NGADLRNVVTEAGFIAIKEDRDYVIQSD 365
>KATL1_RAT (Q5XIK7) Katanin p60 ATPase-containing subunit A-like 1 (EC| 3.6.4.3) (Katanin p60 subunit A-like 1) (p60 katanin-like 1) Length = 488 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRER 216 +SGADI IC ++ L+A+R R Sbjct: 413 YSGADITNICRDASLMAMRRR 433
>KATL1_MOUSE (Q8K0T4) Katanin p60 ATPase-containing subunit A-like 1 (EC| 3.6.4.3) (Katanin p60 subunit A-like 1) (p60 katanin-like 1) Length = 488 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRER 216 +SGADI IC ++ L+A+R R Sbjct: 413 YSGADITNICRDASLMAMRRR 433
>FTSH_TREPA (O83746) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 609 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRERRMKVTHAD 192 +SGAD+ + E+ LLA+R R +V D Sbjct: 344 YSGADLANVVNEAALLAVRSGRAQVIETD 372
>PMP1_SCHPO (O13453) Tyrosine-protein phosphatase pmp1 (EC 3.1.3.48)| Length = 278 Score = 27.7 bits (60), Expect = 7.9 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +2 Query: 23 ICAYPPNQGIY--PTIPNILSLHNVVLVVK 106 +C YPPN +Y PT+P I S V+ V K Sbjct: 62 VCIYPPNIYLYAKPTMPIIQSFDVVINVAK 91
>KATL1_HUMAN (Q9BW62) Katanin p60 ATPase-containing subunit A-like 1 (EC| 3.6.4.3) (Katanin p60 subunit A-like 1) (p60 katanin-like 1) Length = 490 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRER 216 +SGADI +C ++ L+A+R R Sbjct: 415 YSGADITNVCRDASLMAMRRR 435
>ATAD1_RAT (Q505J9) ATPase family AAA domain-containing protein 1| Length = 361 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRE 219 FSG+D+K +C ++ LL +RE Sbjct: 294 FSGSDLKEMCRDAALLCVRE 313
>ATAD1_MOUSE (Q9D5T0) ATPase family AAA domain-containing protein 1| Length = 361 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRE 219 FSG+D+K +C ++ LL +RE Sbjct: 294 FSGSDLKEMCRDAALLCVRE 313
>ATAD1_HUMAN (Q8NBU5) ATPase family AAA domain-containing protein 1| Length = 361 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRE 219 FSG+D+K +C ++ LL +RE Sbjct: 294 FSGSDLKEMCRDAALLCVRE 313
>CDC48_SOYBN (P54774) Cell division cycle protein 48 homolog (Valosin-containing| protein homolog) (VCP) Length = 807 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRER 216 + GAD+ A+CTE+ L +RE+ Sbjct: 410 YVGADLAALCTEAALQCIREK 430
>PRS10_YEAST (P53549) 26S protease subunit RPT4 (26S protease subunit SUG2)| (Proteasomal cap subunit) Length = 437 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRERRMKVTHAD 192 F+GADI+ TE+G A+R+ R + D Sbjct: 386 FNGADIRNCATEAGFFAIRDDRDHINPDD 414
>CDC48_CAPAN (Q96372) Cell division cycle protein 48 homolog| Length = 805 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRER 216 + GAD+ A+CTE+ L +RE+ Sbjct: 410 YVGADLAALCTEAALQCIREK 430
>CD48E_ARATH (Q9LZF6) Cell division control protein 48 homolog E (AtCDC48e)| (Transitional endoplasmic reticulum ATPase E) Length = 810 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRER 216 + GAD+ A+CTE+ L +RE+ Sbjct: 409 YVGADLAALCTEAALQCIREK 429
>CD48A_ARATH (P54609) Cell division control protein 48 homolog A (AtCDC48a)| Length = 809 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRER 216 + GAD+ A+CTE+ L +RE+ Sbjct: 409 YVGADLAALCTEAALQCIREK 429
>KTNA1_XENLA (Q9PUL2) Katanin p60 ATPase-containing subunit (EC 3.6.4.3)| (Katanin p60 subunit) (p60 katanin) (Fragment) Length = 486 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRER 216 +SGADI +C ++ L+A+R R Sbjct: 413 YSGADITNVCRDASLMAMRRR 433
>KTNA1_RAT (Q6E0V2) Katanin p60 ATPase-containing subunit A1 (EC 3.6.4.3)| (Katanin p60 subunit A1) (p60 katanin) Length = 491 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRER 216 +SGADI +C ++ L+A+R R Sbjct: 416 YSGADITNVCRDASLMAMRRR 436
>KTNA1_MOUSE (Q9WV86) Katanin p60 ATPase-containing subunit A1 (EC 3.6.4.3)| (Katanin p60 subunit A1) (p60 katanin) (Lipotransin) Length = 491 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRER 216 +SGADI +C ++ L+A+R R Sbjct: 416 YSGADITNVCRDASLMAMRRR 436
>KTNA1_HUMAN (O75449) Katanin p60 ATPase-containing subunit A1 (EC 3.6.4.3)| (Katanin p60 subunit A1) (p60 katanin) Length = 491 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRER 216 +SGADI +C ++ L+A+R R Sbjct: 416 YSGADITNVCRDASLMAMRRR 436
>FTSH_BACSU (P37476) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 637 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -3 Query: 278 FSGADIKAICTESGLLALRERRMKVTHAD 192 FSGAD++ + E+ L+A R+ + K+ D Sbjct: 365 FSGADLENLLNEAALVAARQNKKKIDARD 393 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,803,043 Number of Sequences: 219361 Number of extensions: 693245 Number of successful extensions: 2008 Number of sequences better than 10.0: 102 Number of HSP's better than 10.0 without gapping: 1943 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2008 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
