| Clone Name | rbags25j21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZAN_MOUSE (O88799) Zonadhesin precursor | 29 | 3.9 | 2 | LIN23_CAEEL (Q09990) F-box/WD-repeat protein lin-23 (Abnormal ce... | 28 | 5.1 |
|---|
>ZAN_MOUSE (O88799) Zonadhesin precursor| Length = 5376 Score = 28.9 bits (63), Expect = 3.9 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +2 Query: 14 NLQGRCIRFTPQVPHYCQHHLLQPDNFXRNKXERDFQGRAXMKLVQLLLXGAHKTW 181 NL G C + +P+VP C+ L + N + Q K + L A KTW Sbjct: 3912 NLDGSCEQTSPKVPSTCKEGCLCQPGYFLNNGKCVLQTHCDCKDAEGGLVPAGKTW 3967
>LIN23_CAEEL (Q09990) F-box/WD-repeat protein lin-23 (Abnormal cell lineage| protein 23) Length = 665 Score = 28.5 bits (62), Expect = 5.1 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +2 Query: 38 FTPQVPHYCQHHLL-QPDNFXRNKXERDFQGRAXMKLVQLLLXGAHKTWITWC 193 F ++ H H+ L + DNF R +RDF LV+L+L + + C Sbjct: 55 FMDKIVHRLSHYQLGKVDNFIRPMLQRDFISNLPAHLVELILFNVNSDSLKSC 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,816,542 Number of Sequences: 219361 Number of extensions: 289411 Number of successful extensions: 573 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 573 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)