ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags25i01 |
|---|---|
| Clone Library Name | barley_pub |
>GLGA_PROMT (Q46LU1) Glycogen synthase (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase) Length = 487 Score = 38.1 bits (87), Expect = 0.012 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +2 Query: 290 TIFISSVELFSDHETCRVRTGWENWPPIILRCTALHTSMVPSWAHPHP 433 T F S+V F+ W +W P +L C HT M+P W H P Sbjct: 106 TFFASAVSEFA----------WNSWKPQVLHCHDWHTGMIPVWMHQDP 143
>GLGA1_SYNY3 (P74521) Glycogen synthase 1 (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase 1) Length = 477 Score = 37.0 bits (84), Expect = 0.026 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 353 WENWPPIILRCTALHTSMVPSWAHPHP 433 W +W P I+ C HT M+P W H P Sbjct: 117 WNHWKPEIIHCHDWHTGMIPVWMHQSP 143
>GLGA_PROMM (Q7V8F0) Glycogen synthase (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase) Length = 499 Score = 35.8 bits (81), Expect = 0.058 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 353 WENWPPIILRCTALHTSMVPSWAHPHP 433 W W P +L C HT M+P W H P Sbjct: 117 WNVWKPQVLHCHDWHTGMIPVWMHQDP 143
>GLGA_PROMP (Q7V275) Glycogen synthase (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase) Length = 483 Score = 35.8 bits (81), Expect = 0.058 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 353 WENWPPIILRCTALHTSMVPSWAHPHP 433 W W P +L C HT M+P W H P Sbjct: 117 WNCWKPQVLHCHDWHTGMIPVWMHQDP 143
>GLGA_PROM9 (Q31BS5) Glycogen synthase (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase) Length = 483 Score = 35.8 bits (81), Expect = 0.058 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 353 WENWPPIILRCTALHTSMVPSWAHPHP 433 W W P +L C HT M+P W H P Sbjct: 117 WNCWKPQVLHCHDWHTGMIPVWMHQDP 143
>GLGA_PROMA (Q7VBP0) Glycogen synthase (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase) Length = 501 Score = 35.8 bits (81), Expect = 0.058 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 353 WENWPPIILRCTALHTSMVPSWAHPHP 433 W W P +L C HT M+P W H P Sbjct: 117 WNVWKPQVLHCHDWHTGMIPVWMHQDP 143
>GLGA_SYNPX (Q7U7I2) Glycogen synthase (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase) Length = 513 Score = 35.8 bits (81), Expect = 0.058 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 353 WENWPPIILRCTALHTSMVPSWAHPHP 433 W W P +L C HT M+P W H P Sbjct: 117 WNVWKPNVLHCHDWHTGMIPVWMHQDP 143
>GLGA_SYNEL (Q8DKU2) Glycogen synthase (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase) Length = 474 Score = 35.8 bits (81), Expect = 0.058 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 353 WENWPPIILRCTALHTSMVPSWAHPHP 433 W W P I+ C HT M+P W H P Sbjct: 117 WNYWKPQIIHCHDWHTGMIPVWMHQDP 143
>GLGA_SYNP7 (Q935Y7) Glycogen synthase (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase) Length = 465 Score = 35.4 bits (80), Expect = 0.075 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 353 WENWPPIILRCTALHTSMVPSWAHPHP 433 W W P ++ C HT M+P W H P Sbjct: 117 WNYWKPQVIHCHDWHTGMIPVWMHQSP 143
>GLGA_SYNP6 (Q5N1P1) Glycogen synthase (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase) Length = 465 Score = 35.4 bits (80), Expect = 0.075 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 353 WENWPPIILRCTALHTSMVPSWAHPHP 433 W W P ++ C HT M+P W H P Sbjct: 117 WNYWKPQVIHCHDWHTGMIPVWMHQSP 143
>GLGA2_ANAVT (Q3M3R4) Glycogen synthase 2 (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase 2) Length = 472 Score = 33.1 bits (74), Expect = 0.37 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 353 WENWPPIILRCTALHTSMVPSWAHPHP 433 W W P I+ C HT M+P W + P Sbjct: 117 WNYWKPEIIHCHDWHTGMIPVWMNQSP 143
>GLGA1_ANASP (Q8YVU5) Glycogen synthase 1 (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase 1) Length = 472 Score = 33.1 bits (74), Expect = 0.37 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 353 WENWPPIILRCTALHTSMVPSWAHPHP 433 W W P I+ C HT M+P W + P Sbjct: 117 WNYWKPDIIHCHDWHTGMIPVWMNQSP 143
>TRA2_PSEFL (Q51761) Putative transposase for insertion sequence IS1162| Length = 558 Score = 29.3 bits (64), Expect = 5.4 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 1/91 (1%) Frame = +1 Query: 100 HGRTNMNKQPRLLP-SAHATGNGHTPSRLRAHESGASHRRDDKG*EILPRSISLLASRDN 276 HG + RL A++T + H P+ +AH R D G I P++ ++ + Sbjct: 376 HGNRRVASHLRLQRRGAYSTQSEHMPASHKAHREWTPQRLLDWGERIGPQTRQIVEHQLT 435 Query: 277 MDPLNHFHLERRALLGS*NMSRSNGMGELAA 369 P H + RA LG +++R G L A Sbjct: 436 HKP--HPEMGYRACLGLLSLARQYGNARLEA 464
>PPDC_ECOLI (P08372) Prepilin peptidase dependent protein C precursor| Length = 107 Score = 28.9 bits (63), Expect = 7.1 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +3 Query: 87 QRQHTWTHEHEQTAPVAAQCPRNWQWSHALKAQGTRIGCVT 209 Q Q W H +QT A P NWQ + + Q ++ GCV+ Sbjct: 46 QYQQLWRHGWQQTQLRAISPPANWQVN---RMQTSQAGCVS 83
>GP132_MOUSE (Q9Z282) Probable G-protein coupled receptor 132 (G2 accumulation| protein) Length = 382 Score = 28.5 bits (62), Expect = 9.2 Identities = 20/78 (25%), Positives = 33/78 (42%), Gaps = 7/78 (8%) Frame = +2 Query: 254 LCWLAVTTWILSTIFISSVELFSDHETCRVRTGWENW-PPIILRC------TALHTSMVP 412 LC V + I++ + S E R+ TGW+ W + C T L T + Sbjct: 292 LCLSTVNSVADPIIYVLGTD-HSRQEVSRIHTGWKKWSTKTYVTCSKDSEETHLPTELSN 350 Query: 413 SWAHPHPGRPGHDRVARL 466 ++ P+P P + A+L Sbjct: 351 TYTFPNPAHPPGSQPAKL 368
>STUB_DROME (Q05319) Serine proteinase stubble (EC 3.4.21.-) (Protein| stubble-stubbloid) [Contains: Serine proteinase stubble non-catalytic chain; Serine proteinase stubble catalytic chain] Length = 787 Score = 28.5 bits (62), Expect = 9.2 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +1 Query: 25 PPPCKGPNYTSTTHTS*ALSYRDSTH-GRTNMNKQPRLLP--SAHATGNGHTPS 177 PPP P TST+ TS +L + TH + + +P+L P S A+ + H PS Sbjct: 351 PPPPSVPPSTSTSTTSTSLIWPAQTHPPQPHRPTRPQLSPGTSLAASSSSHWPS 404 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,075,642 Number of Sequences: 219361 Number of extensions: 1504717 Number of successful extensions: 4252 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 4071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4238 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
