| Clone Name | rbags25h19 |
|---|---|
| Clone Library Name | barley_pub |
>UBP35_HUMAN (Q9P2H5) Ubiquitin carboxyl-terminal hydrolase 35 (EC 3.1.2.15)| (Ubiquitin thioesterase 35) (Ubiquitin-specific-processing protease 35) (Deubiquitinating enzyme 35) Length = 1017 Score = 30.4 bits (67), Expect = 2.2 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = +3 Query: 132 IRLSLRILP*GSSINNVFSTLTVQIAKTICLPPFP 236 ++L L++LP G + + VF+ L ++ +T+C P P Sbjct: 104 VQLGLQLLPEGPAADEVFALLRREVLRTVCERPGP 138
>FTSH_HELFE (O32617) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 638 Score = 30.0 bits (66), Expect = 2.9 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 382 IVQEVQKSMGNKDSGEGSDKKLSRAKKPLIMF 287 + +QK+MG G GS KKL A+KP + F Sbjct: 144 MASRMQKNMGGGIFGMGSSKKLINAEKPKVRF 175
>FTSH_HELPY (P71408) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 632 Score = 28.9 bits (63), Expect = 6.4 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 382 IVQEVQKSMGNKDSGEGSDKKLSRAKKPLIMF 287 + +QK+MG G GS KKL A+KP + F Sbjct: 138 MANRMQKNMGGGIFGMGSAKKLINAEKPNVRF 169
>FTSH_HELPJ (Q9ZM66) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 632 Score = 28.9 bits (63), Expect = 6.4 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 382 IVQEVQKSMGNKDSGEGSDKKLSRAKKPLIMF 287 + +QK+MG G GS KKL A+KP + F Sbjct: 138 MANRMQKNMGGGIFGMGSAKKLINAEKPNVRF 169
>Y678_DROME (Q8T053) Hypothetical zinc finger protein CG2678 in chromosome 3| Length = 434 Score = 28.5 bits (62), Expect = 8.4 Identities = 24/75 (32%), Positives = 31/75 (41%), Gaps = 7/75 (9%) Frame = +2 Query: 188 HFDSTNC*NYLPPSFSAPPHPALFKCLLCKGA---KEHDKWFLRP----GKLFIRSFSAI 346 + +N +L S P H KC C A K+H K LR G L SA+ Sbjct: 230 YMQKSNLKRHLRNHLSKPAH----KCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAV 285 Query: 347 FISHAFLDLLDYPHK 391 FI H L++ HK Sbjct: 286 FIEHVQLEIHRREHK 300 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,955,838 Number of Sequences: 219361 Number of extensions: 1115727 Number of successful extensions: 2652 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2652 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)