| Clone Name | rbags25h06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC ... | 38 | 0.031 | 2 | ERR2_HUMAN (O95718) Steroid hormone receptor ERR2 (Estrogen-rela... | 30 | 8.4 |
|---|
>UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) Length = 1102 Score = 37.7 bits (86), Expect = 0.031 Identities = 27/86 (31%), Positives = 42/86 (48%), Gaps = 4/86 (4%) Frame = -2 Query: 662 RVQKKLRVPNEEFAKWKAAFISMNRPEYLQDIDAVSARFQRRDVYGAWEQ---YLGLEHT 492 R+Q L + +EF K+K A + R +Y+ + + G +LGL+H Sbjct: 1023 RIQSLLDIQEKEFEKFKFAIVMTGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHF 1082 Query: 491 DTTPKRSYTANQNRHTY-EKPVKIYN 417 + PKRS R+TY EK +KI+N Sbjct: 1083 NKAPKRS------RYTYLEKAIKIHN 1102
>ERR2_HUMAN (O95718) Steroid hormone receptor ERR2 (Estrogen-related receptor,| beta) (ERR-beta) (Estrogen receptor-like 2) (ERR beta-2) Length = 500 Score = 29.6 bits (65), Expect = 8.4 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -2 Query: 662 RVQKKLRVPNEEFAKWKAAFISMNRPEYLQDIDAV 558 R KKL+V EEF KA ++ + Y++D++AV Sbjct: 329 RRYKKLKVEKEEFVTLKALALANSDSMYIEDLEAV 363 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,428,043 Number of Sequences: 219361 Number of extensions: 2253367 Number of successful extensions: 5089 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5088 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)