| Clone Name | rbaal1e02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POTE1_MOUSE (Q91WC1) Protection of telomeres 1 (mPot1) (POT1-lik... | 30 | 1.2 | 2 | LASS1_HUMAN (P27544) LAG1 longevity assurance homolog 1 (UOG-1 p... | 29 | 2.6 | 3 | YBXB_BACSU (P37872) Hypothetical protein ybxB (P23) (ORF23) | 28 | 4.5 | 4 | COBT_BRUSU (Q8G155) Nicotinate-nucleotide--dimethylbenzimidazole... | 28 | 5.9 |
|---|
>POTE1_MOUSE (Q91WC1) Protection of telomeres 1 (mPot1) (POT1-like telomere| end-binding protein) Length = 640 Score = 30.4 bits (67), Expect = 1.2 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 187 IYRGGCLGCKTLQKNPRRNLQARFQKMPWT 276 ++ GC C +L+ P +NL +RF K PWT Sbjct: 504 VHHYGCKQCSSLK--PIQNLNSRFHKGPWT 531
>LASS1_HUMAN (P27544) LAG1 longevity assurance homolog 1 (UOG-1 protein) (LAG1| protein) Length = 350 Score = 29.3 bits (64), Expect = 2.6 Identities = 18/55 (32%), Positives = 24/55 (43%) Frame = -1 Query: 285 WKLCPRHLLETSLQIPSRILLQSLAT*ATTPVNWFADARLQGPALLNCCFLVQDS 121 W L R L E + P +LL +L T + A ARL P CC +D+ Sbjct: 42 WGLARRGLAEHAHLAPPELLLLALGALGWTALRSAATARLFRPLAKRCCLQPRDA 96
>YBXB_BACSU (P37872) Hypothetical protein ybxB (P23) (ORF23)| Length = 201 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 85 VQNKKYNYTAKPGILYKKAAVQQGRALQPSVSEPIYRGGCL--GC 213 ++NK + +T+ G+ KK R L S EP GG L GC Sbjct: 23 LRNKDFTFTSDSGVFSKKEVDFGSRLLIDSFEEPEVEGGILDVGC 67
>COBT_BRUSU (Q8G155) Nicotinate-nucleotide--dimethylbenzimidazole| phosphoribosyltransferase (EC 2.4.2.21) (NN:DBI PRT) (N(1)-alpha-phosphoribosyltransferase) Length = 339 Score = 28.1 bits (61), Expect = 5.9 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 133 KKAAVQQGRAL-QPSVSEPIYRGGCLGCKTLQKNPRRNLQARFQKMP 270 K AAV+Q AL QP + +P+ CLG + + L AR +K+P Sbjct: 202 KLAAVRQAVALHQPHLQDPLEVLRCLGGREIAAMAGAILAARMEKIP 248 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,879,844 Number of Sequences: 219361 Number of extensions: 830330 Number of successful extensions: 2053 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2052 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)