| Clone Name | rbags25f17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TDP_DROME (Q24318) Transcription factor dp | 31 | 0.88 | 2 | GPR39_HUMAN (O43194) Probable G-protein coupled receptor 39 | 28 | 4.3 | 3 | PROML_DROME (P82295) Prominin-like protein | 28 | 7.4 | 4 | GLMU_PROMT (Q46LT9) Bifunctional protein glmU [Includes: UDP-N-a... | 28 | 7.4 | 5 | DNJC5_HUMAN (Q9H3Z4) DnaJ homolog subfamily C member 5 (Cysteine... | 27 | 9.7 |
|---|
>TDP_DROME (Q24318) Transcription factor dp| Length = 445 Score = 30.8 bits (68), Expect = 0.88 Identities = 19/63 (30%), Positives = 30/63 (47%) Frame = -2 Query: 237 LVEIGKAWDGEGAECKPSHDISAICLPV*AHQYTRFVCSL*NDQMPGEFQFRASFSLRHQ 58 LVE K + +G P+ I + V H+ T+ CS+ ND+ F+F +F + Sbjct: 286 LVERNKRNESQGVVPSPNASIQLPFIIVNTHKSTKINCSVTNDKSEYIFKFDKTFEMHDD 345 Query: 57 IYV 49 I V Sbjct: 346 IEV 348
>GPR39_HUMAN (O43194) Probable G-protein coupled receptor 39| Length = 453 Score = 28.5 bits (62), Expect = 4.3 Identities = 22/73 (30%), Positives = 37/73 (50%) Frame = +1 Query: 28 NQARIRVNINLMSQRKGSTKLKFTRHLVIL**TDKSSVLMGLDRQAYC*YIM*RLTLCSF 207 N A IRV + Q+KG + + T H+V L +D L+G+ + Y I LT S+ Sbjct: 48 NSATIRVT--QVLQKKGYLQKEVTDHMVSLACSDILVFLIGMPMEFYS-IIWNPLTTSSY 104 Query: 208 TIPCLAYFYKYSS 246 T+ C + + + + Sbjct: 105 TLSCKLHTFLFEA 117
>PROML_DROME (P82295) Prominin-like protein| Length = 1013 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -1 Query: 289 LLFVYIVLVTCYPCHCCTCRNRQG 218 L+ V + CY C CC R RQG Sbjct: 176 LIIVIPFIAVCYCCFCCCRRCRQG 199
>GLMU_PROMT (Q46LT9) Bifunctional protein glmU [Includes:| UDP-N-acetylglucosamine pyrophosphorylase (EC 2.7.7.23) (N-acetylglucosamine-1-phosphate uridyltransferase); Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)] Length = 446 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 72 KRKHETEIHQAFGHSIMNRQIECTDGLRPAGILLI 176 K K +H G S+++R + CT GL+P L++ Sbjct: 16 KSKLPKVLHPLAGKSLIDRVLSCTHGLKPNRRLIV 50
>DNJC5_HUMAN (Q9H3Z4) DnaJ homolog subfamily C member 5 (Cysteine string| protein) (CSP) Length = 198 Score = 27.3 bits (59), Expect = 9.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 286 LFVYIVLVTCYPCHCCTC 233 LFV+ L+TC C CC C Sbjct: 109 LFVFCGLLTCCYCCCCLC 126 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,372,031 Number of Sequences: 219361 Number of extensions: 870995 Number of successful extensions: 2185 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2183 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)