| Clone Name | rbags25f13 |
|---|---|
| Clone Library Name | barley_pub |
>KE4_PONPY (Q5RFD5) Zinc transporter SLC39A7 (Solute carrier family 39 member| 7) (Histidine-rich membrane protein Ke4) Length = 469 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 24 HIHSHRQHSHTSMFSRAMLVHEHGHTH 104 H HSHR HSH H HGHTH Sbjct: 43 HGHSHR-HSHEDFHHGHSHAHGHGHTH 68 Score = 28.1 bits (61), Expect = 6.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 9 YXAYVHIHSHRQHSHTSMFSRAMLVHEHGHTH 104 + + H H H H+H S++ H+HGH+H Sbjct: 55 HHGHSHAHGHG-HTHESIWHGHTHGHDHGHSH 85
>KE4_HUMAN (Q92504) Zinc transporter SLC39A7 (Solute carrier family 39 member| 7) (Histidine-rich membrane protein Ke4) Length = 469 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 24 HIHSHRQHSHTSMFSRAMLVHEHGHTH 104 H HSHR HSH H HGHTH Sbjct: 43 HGHSHR-HSHEDFHHGHSHAHGHGHTH 68 Score = 28.1 bits (61), Expect = 6.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 9 YXAYVHIHSHRQHSHTSMFSRAMLVHEHGHTH 104 + + H H H H+H S++ H+HGH+H Sbjct: 55 HHGHSHAHGHG-HTHESIWHGHTHDHDHGHSH 85
>ZIP1_ARATH (O81123) Zinc transporter 1 precursor (ZRT/IRT-like protein 1)| Length = 355 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 9 YXAYVHIHSHRQHSHTSMFSRAMLVHEHGHTHILRNK 119 + +VHIH+H H HT HG T ++R + Sbjct: 173 HAGHVHIHTHASHGHT-----------HGSTELIRRR 198
>SRCH_HUMAN (P23327) Sarcoplasmic reticulum histidine-rich calcium-binding| protein precursor Length = 699 Score = 29.3 bits (64), Expect = 2.9 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 24 HIHSHRQHSHTSMFSRAMLVHEHGHTHILRN 116 H+ SHR HSH ++ EH H HILR+ Sbjct: 151 HLPSHRSHSHQDEDEDEVVSSEH-HHHILRH 180
>HNF1B_XENLA (Q91910) Hepatocyte nuclear factor 1-beta (HNF-1B) (LFB3) (XLFB3)| Length = 561 Score = 29.3 bits (64), Expect = 2.9 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 18 YVHIHSHRQHSHTSMFSRAMLVHEHGHTHILRN 116 Y H H Q+SHTS F AM+V + L N Sbjct: 517 YAHKHEPPQYSHTSRFPSAMVVTDTSSISTLSN 549
>KE4_MOUSE (Q31125) Zinc transporter SLC39A7 (Solute carrier family 39 member| 7) (Histidine-rich membrane protein Ke4) Length = 476 Score = 28.9 bits (63), Expect = 3.8 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 9 YXAYVHIHSHRQ--HSHTSMFSRAMLVHEHGHTH 104 + + H HSH H H+ S H HGHTH Sbjct: 42 FHGHSHGHSHEDFHHGHSHGHSHEDFHHGHGHTH 75
>ENGC_PROMA (Q7VEJ4) Probable GTPase engC (EC 3.6.1.-)| Length = 309 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 95 TYTYS*EQIRKINGEGKPKAMSELTKLQWHFICGPSSV 208 T+ Y I +NGEG K + L ++ +CGPS V Sbjct: 156 TWGYQPIPISIVNGEGIQKLSARLKSMKLGVLCGPSGV 193
>KE4_CANFA (Q5TJF6) Zinc transporter SLC39A7 (Solute carrier family 39 member| 7) (Histidine-rich membrane protein Ke4) Length = 469 Score = 28.5 bits (62), Expect = 5.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 24 HIHSHRQHSHTSMFSRAMLVHEHGHTH 104 H HSHR+ SH H HGHTH Sbjct: 43 HGHSHRR-SHEDFHHGHSYAHGHGHTH 68
>BUD3_ASHGO (Q9HF61) Bud site selection protein BUD3| Length = 1478 Score = 28.1 bits (61), Expect = 6.5 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 24 HIHSHRQHSHTSMFSRAMLVHEHGHTHILRNK*ER*MEKENPKQ 155 H +++ S+ S H++G HILRN E E+P+Q Sbjct: 818 HKKDKKENKRNSVGSDTRNRHDNGSVHILRNSSSSFRELESPRQ 861 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,754,736 Number of Sequences: 219361 Number of extensions: 514756 Number of successful extensions: 1376 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1365 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)