| Clone Name | rbags25f12 |
|---|---|
| Clone Library Name | barley_pub |
>NUAM_ARATH (Q9FGI6) NADH-ubiquinone oxidoreductase 75 kDa subunit,| mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-75Kd) (CI-75Kd) (75 kDa mitochondrial complex I subunit) Length = 748 Score = 51.2 bits (121), Expect = 6e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 400 FKAAVXNFYMTDAITRASKIMAQCSATLLKK 308 F+ V NFYMT++ITRASKIMAQCSA LLKK Sbjct: 715 FQTVVENFYMTNSITRASKIMAQCSAVLLKK 745
>NUAM_SOLTU (Q43644) NADH-ubiquinone oxidoreductase 75 kDa subunit,| mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-75KD) (CI-75KD) (76 kDa mitochondrial complex I subunit) Length = 738 Score = 50.1 bits (118), Expect = 1e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 400 FKAAVXNFYMTDAITRASKIMAQCSATLLK 311 F AV NFYMTDAITRASKIMAQCSA L K Sbjct: 709 FTPAVENFYMTDAITRASKIMAQCSALLKK 738
>NUAM_NEUCR (P24918) NADH-ubiquinone oxidoreductase 78 kDa subunit,| mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-78KD) (CI-78KD) Length = 744 Score = 35.4 bits (80), Expect = 0.033 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -1 Query: 397 KAAVXNFYMTDAITRASKIMAQCSA 323 K + NFY TDAI+R+S MA+CSA Sbjct: 691 KKVIENFYFTDAISRSSPTMARCSA 715
>NUAM_RECAM (O21241) NADH-ubiquinone oxidoreductase 75 kDa subunit (EC 1.6.5.3)| (EC 1.6.99.3) (Complex I-75KD) (CI-75KD) (NADH dehydrogenase subunit 11) Length = 691 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = -1 Query: 400 FKAAVXNFYMTDAITRASKIMAQCSA 323 FK NFY+T+AI R+S+ MA+CS+ Sbjct: 661 FKPLFNNFYLTNAICRSSQTMAKCSS 686
>NUAM_PONPY (Q5R911) NADH-ubiquinone oxidoreductase 75 kDa subunit,| mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-75Kd) (CI-75Kd) Length = 727 Score = 31.6 bits (70), Expect = 0.48 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = -1 Query: 388 VXNFYMTDAITRASKIMAQC 329 + +FYMTD+I+RAS+ MA+C Sbjct: 691 IKDFYMTDSISRASQTMAKC 710
>NUAM_MOUSE (Q91VD9) NADH-ubiquinone oxidoreductase 75 kDa subunit,| mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-75Kd) (CI-75Kd) Length = 727 Score = 31.6 bits (70), Expect = 0.48 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = -1 Query: 388 VXNFYMTDAITRASKIMAQC 329 + +FYMTD+I+RAS+ MA+C Sbjct: 691 IKDFYMTDSISRASQTMAKC 710
>NUAM_HUMAN (P28331) NADH-ubiquinone oxidoreductase 75 kDa subunit,| mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-75Kd) (CI-75Kd) Length = 727 Score = 31.6 bits (70), Expect = 0.48 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = -1 Query: 388 VXNFYMTDAITRASKIMAQC 329 + +FYMTD+I+RAS+ MA+C Sbjct: 691 IKDFYMTDSISRASQTMAKC 710
>NUAM_BOVIN (P15690) NADH-ubiquinone oxidoreductase 75 kDa subunit,| mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-75Kd) (CI-75Kd) Length = 727 Score = 31.6 bits (70), Expect = 0.48 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = -1 Query: 388 VXNFYMTDAITRASKIMAQC 329 + +FYMTD+I+RAS+ MA+C Sbjct: 691 IKDFYMTDSISRASQTMAKC 710
>NUAM_DROME (Q94511) NADH-ubiquinone oxidoreductase 75 kDa subunit,| mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-75Kd) (CI-75Kd) Length = 731 Score = 29.6 bits (65), Expect = 1.8 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = -1 Query: 382 NFYMTDAITRASKIMAQCSATLLKK 308 +++MTDAI+RAS MA+C + + K+ Sbjct: 695 DYFMTDAISRASPTMAKCISAVNKQ 719
>ASPM_SHEEP (P62297) Abnormal spindle-like microcephaly-associated protein| homolog (Fragment) Length = 3374 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 20 SWNRGNEQAKTRNTTKLFACSCRLIRKDNKL 112 SW + N+ +KT+ + C R IR++NKL Sbjct: 3137 SWRKKNDTSKTKAIRQRLQCVNREIREENKL 3167
>NUAM_ACACA (Q37373) NADH-ubiquinone oxidoreductase 75 kDa subunit (EC 1.6.5.3)| (EC 1.6.99.3) (Complex I-75KD) (CI-75KD) (NADH dehydrogenase subunit 11) Length = 675 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 382 NFYMTDAITRASKIMAQC 329 N+Y+ D+ITR SKIM+ C Sbjct: 646 NYYIYDSITRNSKIMSLC 663
>NET4_HUMAN (Q9HB63) Netrin-4 precursor (Beta-netrin) (Hepar-derived| netrin-like protein) Length = 628 Score = 27.7 bits (60), Expect = 6.9 Identities = 17/60 (28%), Positives = 21/60 (35%) Frame = +2 Query: 212 IXPANQATTTGERNGKGQLKSCLPVIT*SRASLLQQGCTALSHYF*SPCDCIGHVEVLHG 391 + PAN T NG C P + R G Y PCDC G + + G Sbjct: 404 VLPANSVTFCDPSNGDCP---CKPGVAGRRCDRCMVGYWGFGDYGCRPCDCAGSCDPITG 460 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,335,420 Number of Sequences: 219361 Number of extensions: 850427 Number of successful extensions: 1500 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1500 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)