| Clone Name | rbaal1d24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NLTP3_HORVU (Q43766) Nonspecific lipid-transfer protein 3 precur... | 39 | 0.015 | 2 | DXS_THEMA (Q9X291) 1-deoxy-D-xylulose-5-phosphate synthase (EC 2... | 32 | 1.9 | 3 | WT1_PIG (O62651) Wilms' tumor protein homolog | 30 | 4.2 | 4 | NLTP3_ARATH (Q9LLR7) Nonspecific lipid-transfer protein 3 precur... | 30 | 7.2 | 5 | SCA_LILLO (Q9SW93) Stigma/stylar cysteine-rich adhesin precursor... | 29 | 9.4 |
|---|
>NLTP3_HORVU (Q43766) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| (CW20) (CW-20) (CW-19) Length = 118 Score = 38.5 bits (88), Expect = 0.015 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 608 SVPFPISMSTDCNKVH 561 SVPFPISMSTDCNKVH Sbjct: 103 SVPFPISMSTDCNKVH 118
>DXS_THEMA (Q9X291) 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7)| (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) Length = 608 Score = 31.6 bits (70), Expect = 1.9 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = -1 Query: 172 ALYRCFEPQEDACVWDS 122 ALYR F+P+EDA +WD+ Sbjct: 48 ALYRVFDPREDAIIWDT 64
>WT1_PIG (O62651) Wilms' tumor protein homolog| Length = 449 Score = 30.4 bits (67), Expect = 4.2 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +3 Query: 69 TSGDFVHLEHKSGHGALHESQTHASS--CGSKHRYSAH 176 TS E +S HGA +ES +HA+ CG+++R H Sbjct: 254 TSSSMKWTEGQSNHGAGYESDSHATPILCGAQYRIHTH 291
>NLTP3_ARATH (Q9LLR7) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 115 Score = 29.6 bits (65), Expect = 7.2 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -3 Query: 608 SVPFPISMSTDCNKV 564 S+P+PISMST+CN + Sbjct: 100 SIPYPISMSTNCNNI 114
>SCA_LILLO (Q9SW93) Stigma/stylar cysteine-rich adhesin precursor (Lipid| transfer protein) Length = 113 Score = 29.3 bits (64), Expect = 9.4 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 608 SVPFPISMSTDCNKV 564 ++P+PI M TDCNKV Sbjct: 98 NIPYPIRMQTDCNKV 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,671,304 Number of Sequences: 219361 Number of extensions: 1947921 Number of successful extensions: 4023 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4020 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5424720305 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)