ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags24o03 |
|---|---|
| Clone Library Name | barley_pub |
>FTRC_MAIZE (P41347) Ferredoxin-thioredoxin reductase catalytic chain,| chloroplast precursor (EC 1.18.-.-) (FTR-C) (Ferredoxin-thioredoxin reductase subunit B) (FTR-B) Length = 152 Score = 35.0 bits (79), Expect = 0.22 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = -2 Query: 455 RSRAEQYAHHSSTFFCYEKSFTAVGIK 375 R +EQYA S+TFFC +K+ TAV IK Sbjct: 51 RKFSEQYARRSNTFFCADKTVTAVVIK 77 Score = 34.7 bits (78), Expect = 0.29 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 621 AEQYAHRSGTFLCYDECVTAVGIK 550 +EQYA RS TF C D+ VTAV IK Sbjct: 54 SEQYARRSNTFFCADKTVTAVVIK 77
>FTRC2_SPIOL (P41349) Ferredoxin-thioredoxin reductase catalytic chain,| chloroplast precursor (EC 1.18.-.-) (FTR-C) (Ferredoxin-thioredoxin reductase subunit B) (FTR-B) (B1) Length = 148 Score = 33.1 bits (74), Expect = 0.85 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = -1 Query: 621 AEQYAHRSGTFLCYDECVTAVGIK 550 +EQYA +SGT+ C D+ VT+V IK Sbjct: 50 SEQYARKSGTYFCVDKGVTSVVIK 73 Score = 32.0 bits (71), Expect = 1.9 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -2 Query: 455 RSRAEQYAHHSSTFFCYEKSFTAVGIK 375 R +EQYA S T+FC +K T+V IK Sbjct: 47 RKFSEQYARKSGTYFCVDKGVTSVVIK 73
>FTRC_SOYBN (O49856) Ferredoxin-thioredoxin reductase catalytic chain,| chloroplast precursor (EC 1.18.-.-) (FTR-C) Length = 144 Score = 33.1 bits (74), Expect = 0.85 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = -1 Query: 621 AEQYAHRSGTFLCYDECVTAVGIK 550 +EQYA +SGT+ C D+ VT+V IK Sbjct: 46 SEQYARKSGTYFCVDKGVTSVVIK 69 Score = 32.0 bits (71), Expect = 1.9 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -2 Query: 455 RSRAEQYAHHSSTFFCYEKSFTAVGIK 375 R +EQYA S T+FC +K T+V IK Sbjct: 43 RKFSEQYARKSGTYFCVDKGVTSVVIK 69
>FTRC1_SPIOL (P41348) Ferredoxin-thioredoxin reductase catalytic chain,| chloroplast precursor (EC 1.18.-.-) (FTR-C) (Ferredoxin-thioredoxin reductase subunit B) (FTR-B) (B2) Length = 144 Score = 31.6 bits (70), Expect = 2.5 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -2 Query: 455 RSRAEQYAHHSSTFFCYEKSFTAVGIK 375 R +EQ+ S T+FC +KS TAV IK Sbjct: 43 RKFSEQFCRKSDTYFCVDKSVTAVVIK 69
>GAG_FOAMV (P14349) Gag polyprotein (Core polyprotein) [Contains: Protease (EC| 3.4.23.-)] Length = 811 Score = 31.2 bits (69), Expect = 3.2 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -2 Query: 518 PRKQKGRGKGRNVTRETDGPSRS 450 PR +GRG+G+N +R + GP+ S Sbjct: 484 PRPSRGRGRGQNTSRPSQGPANS 506
>CHVA_AGRTU (P0A2V1) Beta-(1-->2)glucan export ATP-binding protein chvA| (Attachment protein) Length = 588 Score = 31.2 bits (69), Expect = 3.2 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +1 Query: 394 KDFS*QKKVLEWWAYCSALLREGPSVSLVTFL 489 K S Q VL+WWA+ SAL R +VS++ L Sbjct: 227 KLLSAQYPVLDWWAFASALNRTASTVSMMIIL 258
>CHVA_AGRT5 (P0A2V0) Beta-(1-->2)glucan export ATP-binding protein chvA| (Attachment protein) Length = 588 Score = 31.2 bits (69), Expect = 3.2 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +1 Query: 394 KDFS*QKKVLEWWAYCSALLREGPSVSLVTFL 489 K S Q VL+WWA+ SAL R +VS++ L Sbjct: 227 KLLSAQYPVLDWWAFASALNRTASTVSMMIIL 258
>FTRC_PORPU (P51386) Ferredoxin-thioredoxin reductase, catalytic chain (EC| 1.18.-.-) (FTR-C) (Ferredoxin-thioredoxin reductase subunit B) (FTR-B) Length = 118 Score = 31.2 bits (69), Expect = 3.2 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -1 Query: 621 AEQYAHRSGTFLCYDECVTAVGIK 550 +E YA R+GTF C D VTAV I+ Sbjct: 20 SETYAKRTGTFFCADNSVTAVVIE 43
>VPS35_YEAST (P34110) Vacuolar protein sorting-associated protein VPS35| Length = 944 Score = 30.8 bits (68), Expect = 4.2 Identities = 21/67 (31%), Positives = 30/67 (44%) Frame = +1 Query: 427 WWAYCSALLREGPSVSLVTFLPLPRPFCFLGGHLKPNNLSHLDADSSDTLVIAQKGTGAV 606 +W Y + L E P +SL F+PL L PNN +L+ + ++ K G Sbjct: 316 FWDYLTVLNHERPDLSLQQFIPLVESVIVLSLKWYPNNFDNLN-KLFELVLQKTKDYGQK 374 Query: 607 GILLRSE 627 I L SE Sbjct: 375 NISLESE 381
>POL_HV2NZ (P05962) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1460 Score = 30.8 bits (68), Expect = 4.2 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -3 Query: 460 PLGAEQSSMPTTPAPFSATRSPSPLSASSCPWFDSSQERICAKG 329 PLG E +P P+P A + +P+ +SS P + R AKG Sbjct: 434 PLGKEGPQLPRGPSPAGANTNSTPIGSSSGPTGEIYAARKKAKG 477
>TRBE2_RHISN (P55399) Probable conjugal transfer protein trbE part 2| Length = 662 Score = 30.8 bits (68), Expect = 4.2 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = -3 Query: 526 GDLPGSKKGVAREGMLQEKRMA---PLGAEQSSMPTTPAPFSATRSPSPLSASS 374 G LPG+ RE ++ +A PL + S P P PF SPS + +S Sbjct: 233 GSLPGNWYCNIREPLINTSNLADLIPLNSVWSGSPVAPCPFYPPNSPSLMQVAS 286
>WNK4_HUMAN (Q96J92) Serine/threonine-protein kinase WNK4 (EC 2.7.11.1)| (Protein kinase with no lysine 4) (Protein kinase, lysine-deficient 4) Length = 1243 Score = 30.4 bits (67), Expect = 5.5 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 5/38 (13%) Frame = -3 Query: 463 APLGAEQSSMPT-----TPAPFSATRSPSPLSASSCPW 365 +P+ ++ SS P+ +P PFS++ P+ S CPW Sbjct: 844 SPISSQVSSNPSPHPTSSPLPFSSSTPEFPVPLSQCPW 881
>ARCA_HAEIN (P44918) Aerobic respiration control protein arcA homolog| Length = 236 Score = 30.4 bits (67), Expect = 5.5 Identities = 26/112 (23%), Positives = 49/112 (43%), Gaps = 5/112 (4%) Frame = -1 Query: 678 VTIFGKGSNVTRAGDVPLGAEQYAHRSGTFLCYDECVTAVGIKMREIIWFEVTSQEAKRA 499 + + G+ + V + + +GA+ Y + + I+ R ++ + QE + Sbjct: 78 IFLTGRDNEVDKILGLEIGADDYLTKPFN-------PRELTIRARNLLHRAMPHQEKENT 130 Query: 498 WQGKECYKRNGWPLSEQSRAVCPPLQHLFLL-----REVLHRCRHQAAPGSI 358 + G+E Y+ NGW L S ++ P F L R +LH C + PG + Sbjct: 131 F-GREFYRFNGWKLDLNSHSLITPEGQEFKLPRSEFRAMLHFCEN---PGKL 178
>ALG2_ASHGO (Q755C1) Alpha-1,3-mannosyltransferase ALG2 (EC 2.4.1.-)| (GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase) (Asparagine-linked glycosylation protein 2) Length = 514 Score = 30.0 bits (66), Expect = 7.2 Identities = 29/106 (27%), Positives = 42/106 (39%), Gaps = 10/106 (9%) Frame = -2 Query: 449 RAEQYAHHSSTFFCYEK------SFTAVGIKLPL----VRFLPRADLRQRATFLAHADNG 300 R Y H C+E+ VG LP F+ A+LRQ A NG Sbjct: 36 RVTIYTSHCDKNHCFEEIKRGDLKVVVVGDFLPTNILGKFFILCANLRQLALVFKLVING 95 Query: 299 HWLLHNNDKHDGLDYLT*IISLFVVSTISSCLPLYQILYCNSQVTY 162 + DKHD LF+V +S+C+PL + + +V + Sbjct: 96 -----SIDKHD----------LFIVDQLSTCVPLLHLFSASGRVLF 126
>YMDA_CHLAU (Q45826) Hypothetical RNA pseudouridine synthase in mdh 5'region| (EC 5.4.99.-) (RNA-uridine isomerase) (RNA pseudouridylate synthase) (ORFA) (Fragment) Length = 253 Score = 30.0 bits (66), Expect = 7.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +1 Query: 463 PSVSLVTFLPLPRPFCFLGGHLKPNNLSHLDADSSDTLVIAQ 588 P +LV L P +GG L+P + LD D+S LVIA+ Sbjct: 55 PRGTLVNALLARYPDLAIGGELRPGIVHRLDRDTSGLLVIAR 96
>OR4D6_HUMAN (Q8NGJ1) Olfactory receptor 4D6 (Olfactory receptor OR11-250)| Length = 314 Score = 29.6 bits (65), Expect = 9.4 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -1 Query: 240 FPFCGVNDLFMFTAVSNTIL*LASYLQPAILLFSVA-NGLVCIQFYLL 100 FPFCG N L F ++ LA A+ LF ++ NGLV + ++LL Sbjct: 166 FPFCGPNTLDAFYCYVLQVVKLACTDTFALELFMISNNGLVTLLWFLL 213
>TENX_HUMAN (P22105) Tenascin-X precursor (TN-X) (Hexabrachion-like protein)| Length = 4289 Score = 29.6 bits (65), Expect = 9.4 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = -3 Query: 550 DERDYLV*GDLPGSKKGVAREGMLQEKRMAPLGAEQSSMP--TTPAPFSATRSPSP 389 D+R V PG K G+L KR+ P+ A + P TPAP A +P P Sbjct: 3543 DQRTVTVEDLEPGKKYKFLLYGLLGGKRLGPVSALGMTAPEEDTPAPELAPEAPEP 3598 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 104,423,181 Number of Sequences: 219361 Number of extensions: 2232340 Number of successful extensions: 7532 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 6982 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7525 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7082949625 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
