| Clone Name | rbags25c20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SLIK6_MOUSE (Q8C110) SLIT and NTRK-like protein 6 precursor | 28 | 6.2 | 2 | SLIK6_HUMAN (Q9H5Y7) SLIT and NTRK-like protein 6 precursor | 28 | 8.1 | 3 | PECA1_BOVIN (P51866) Platelet endothelial cell adhesion molecule... | 28 | 8.1 |
|---|
>SLIK6_MOUSE (Q8C110) SLIT and NTRK-like protein 6 precursor| Length = 840 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 16 PTHARYQLYLYCLQSHYTTRLQHSLYEQRVAT 111 P H +Y +Y + H T R SLYEQ + + Sbjct: 652 PVHLQYSMYGHKTTHHTTERPSSSLYEQHMVS 683
>SLIK6_HUMAN (Q9H5Y7) SLIT and NTRK-like protein 6 precursor| Length = 841 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 16 PTHARYQLYLYCLQSHYTTRLQHSLYEQRVAT 111 P H +Y +Y + H T R SLYEQ + + Sbjct: 653 PVHLQYSMYGHKTTHHTTERPSASLYEQHMVS 684
>PECA1_BOVIN (P51866) Platelet endothelial cell adhesion molecule precursor| (PECAM-1) (CD31 antigen) Length = 739 Score = 27.7 bits (60), Expect = 8.1 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -3 Query: 139 ISSRRASLSELLHAARITNVVTASCNVIVSN-TSTTGTVRAWV 14 +SSRR + S L+ R+ + CNVI++N TT WV Sbjct: 85 VSSRRNTESYLIPHVRVCDSGRYKCNVILNNKEKTTPEYEVWV 127 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,689,685 Number of Sequences: 219361 Number of extensions: 393592 Number of successful extensions: 918 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 914 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 918 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)