| Clone Name | rbaal1d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RCAA_HORVU (Q40073) Ribulose bisphosphate carboxylase/oxygenase ... | 80 | 2e-15 | 2 | RCA_ARATH (P10896) Ribulose bisphosphate carboxylase/oxygenase a... | 64 | 8e-11 | 3 | RCA1_LARTR (Q7X9A0) Ribulose bisphosphate carboxylase/oxygenase ... | 64 | 1e-10 | 4 | RCA_SPIOL (P10871) Ribulose bisphosphate carboxylase/oxygenase a... | 59 | 3e-09 | 5 | PURQ_RHILO (Q98NN0) Phosphoribosylformylglycinamidine synthase I... | 28 | 6.4 |
|---|
>RCAA_HORVU (Q40073) Ribulose bisphosphate carboxylase/oxygenase activase A,| chloroplast precursor (RuBisCO activase A) (RA A) Length = 464 Score = 79.7 bits (195), Expect = 2e-15 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = -1 Query: 205 KGAQQGXLPVPEGCTDQNAXNYDPTARSDDGSCLYTF 95 KGAQQG LPVPEGCTDQNA NYDPTARSDDGSCLYTF Sbjct: 428 KGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF 464
>RCA_ARATH (P10896) Ribulose bisphosphate carboxylase/oxygenase activase,| chloroplast precursor (RuBisCO activase) (RA) Length = 474 Score = 64.3 bits (155), Expect = 8e-11 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 205 KGAQQGXLPVPEGCTDQNAXNYDPTARSDDGSCLYTF 95 KGAQQ LPVPEGCTD A N+DPTARSDDG+C+Y F Sbjct: 438 KGAQQVNLPVPEGCTDPVAENFDPTARSDDGTCVYNF 474
>RCA1_LARTR (Q7X9A0) Ribulose bisphosphate carboxylase/oxygenase activase 1,| chloroplast precursor (RuBisCO activase 1) (RA 1) (RubisCO activase alpha form) Length = 476 Score = 63.5 bits (153), Expect = 1e-10 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = -1 Query: 214 GXKKGAQQGXLPVPEGCTDQNAXNYDPTARSDDGSCLYTF 95 G + Q G +PVPEGCTD A NYDPTARSDDGSC+Y F Sbjct: 437 GGQAAQQVGNVPVPEGCTDPQATNYDPTARSDDGSCVYKF 476
>RCA_SPIOL (P10871) Ribulose bisphosphate carboxylase/oxygenase activase,| chloroplast precursor (RuBisCO activase) (RA) Length = 472 Score = 58.9 bits (141), Expect = 3e-09 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -1 Query: 205 KGAQQGXLPVPEGCTDQNAXNYDPTARSDDGSCLY 101 K AQQ LPV +GCTD A NYDPTARSDDGSC Y Sbjct: 436 KAAQQVSLPVAQGCTDPEAKNYDPTARSDDGSCTY 470
>PURQ_RHILO (Q98NN0) Phosphoribosylformylglycinamidine synthase I (EC 6.3.5.3)| (FGAM synthase I) Length = 222 Score = 28.1 bits (61), Expect = 6.4 Identities = 14/57 (24%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = +2 Query: 38 WMRCGLR*VKHXILKVACLKGVKAAAVVAPCRWVVVL---GILVGATFRHGQXTLLC 199 ++RCG + +++ K K V+ C +L G+L GA R+ +C Sbjct: 56 YLRCGAIAARMPVMRAVAEKAAKGVTVIGVCNGFQILVEAGLLPGALMRNTSLKFVC 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,465,963 Number of Sequences: 219361 Number of extensions: 382366 Number of successful extensions: 731 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 731 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)