| Clone Name | rbags24k17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GML_HUMAN (Q99445) Glycosyl-phosphatidylinositol-anchored molecu... | 31 | 0.84 | 2 | CST11_RAT (Q8K5A3) Cystatin-11 precursor | 29 | 2.4 | 3 | GPMI_PSEPK (Q88CX4) 2,3-bisphosphoglycerate-independent phosphog... | 28 | 5.5 | 4 | KNAP3_MALDO (O04136) Homeobox protein knotted-1-like 3 (KNAP3) | 28 | 5.5 | 5 | CUBN_CANFA (Q9TU53) Cubilin precursor | 28 | 7.1 | 6 | FOXP3_MOUSE (Q99JB6) Forkhead box protein P3 (Scurfin) | 28 | 7.1 | 7 | CST11_MOUSE (Q9D269) Cystatin-11 precursor | 28 | 7.1 |
|---|
>GML_HUMAN (Q99445) Glycosyl-phosphatidylinositol-anchored molecule-like| protein precursor Length = 158 Score = 30.8 bits (68), Expect = 0.84 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +1 Query: 175 YYNCTKNCTLQHNASHYKYHEGRIPFT*MSLRWSCTSSDSVC 300 Y NCT NCT + A G+I F S W C + VC Sbjct: 70 YKNCTNNCTFVYAAEQPPEAPGKI-FKTNSFYWVCCCNSMVC 110
>CST11_RAT (Q8K5A3) Cystatin-11 precursor| Length = 139 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = +2 Query: 170 HLTTTVQKTVHYNTTPHTTNIMKGGFHSHRCHYVGLARLPILSAWKLLR 316 H+T +Q+T T + N+ +G H Y + +P L +K+L+ Sbjct: 84 HITVEMQRTTCLKTEKNLCNVQEGELHKQIQCYFSVYVIPWLEVFKMLK 132
>GPMI_PSEPK (Q88CX4) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) Length = 511 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 173 LTTTVQKTVHYNTTPHTTNIMK-GGFHSHRCHYVGLARL 286 LT V K V H ++ GG HSH+ H V +A L Sbjct: 99 LTGAVDKAVGAGKAVHILGLLSDGGVHSHQDHLVAMAEL 137
>KNAP3_MALDO (O04136) Homeobox protein knotted-1-like 3 (KNAP3)| Length = 427 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 118 PYHSV*AIPNWTSRLLCTSYYNCTKNCTLQHNASH 222 P+HS PNW + L ++ N N T +NA++ Sbjct: 41 PHHSFQPAPNWLNSALLRNFTNTDTNPTNSNNANN 75
>CUBN_CANFA (Q9TU53) Cubilin precursor| Length = 3620 Score = 27.7 bits (60), Expect = 7.1 Identities = 16/62 (25%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = +2 Query: 119 HTIRCELYLIGHPGCYVHLT-TTVQKTVHYNTTPHTTNIMKGGFHSHRCHYVGLARLPIL 295 H I C +++ PG +HL HYN T + G +++ Y G + P L Sbjct: 950 HGINCTWHILVQPGHLIHLIFRKFHLEFHYNCTNDYLEVYDTGSNTYLGRYCGKSIPPSL 1009 Query: 296 SA 301 ++ Sbjct: 1010 TS 1011
>FOXP3_MOUSE (Q99JB6) Forkhead box protein P3 (Scurfin)| Length = 429 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +1 Query: 208 HNASHYKYHEGRIPFT*MSL-RWS 276 HN ++KYH R PFT +L RW+ Sbjct: 326 HNMDYFKYHNMRPPFTYATLIRWA 349
>CST11_MOUSE (Q9D269) Cystatin-11 precursor| Length = 139 Score = 27.7 bits (60), Expect = 7.1 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = +2 Query: 170 HLTTTVQKTVHYNTTPHTTNIMKGGFHSHRCHYVGLARLPILSAWKLLR 316 H+T +Q+T T +I KG H Y + +P + +K+L+ Sbjct: 84 HITVEMQRTTCLKTETSLCDIQKGELHKKIQCYFSVYAIPWVEVFKILK 132 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,995,353 Number of Sequences: 219361 Number of extensions: 994776 Number of successful extensions: 2536 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2536 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)