| Clone Name | rbags24k13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UNC47_CAEEL (P34579) Vesicular GABA transporter (Uncoordinated p... | 28 | 5.8 | 2 | NFYA7_ARATH (Q84JP1) Nuclear transcription factor Y subunit A-7 ... | 28 | 7.6 | 3 | GLPF_MYCGE (P47279) Probable glycerol uptake facilitator protein | 28 | 7.6 |
|---|
>UNC47_CAEEL (P34579) Vesicular GABA transporter (Uncoordinated protein 47)| (Protein unc-47) Length = 486 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +3 Query: 174 IDGWWLLHEMVGTFQTVVGDGTXMLTCLVTDRYQGGVLGSSGWRRL 311 + GWW + MVG G ++ CL Y+ GV +R + Sbjct: 116 VGGWWSIGAMVGVAYVCYWTGVLLIECL----YENGVKKRKTYREI 157
>NFYA7_ARATH (Q84JP1) Nuclear transcription factor Y subunit A-7 (AtNF-YA-7)| Length = 190 Score = 27.7 bits (60), Expect = 7.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 58 ELHGRLYRLDGRLTLQ*QDKQAKNRRP*VHHSQ 156 + HG L R R L+ Q+K K+R+P +H S+ Sbjct: 108 QYHGILRRRQSRARLESQNKVIKSRKPYLHESR 140
>GLPF_MYCGE (P47279) Probable glycerol uptake facilitator protein| Length = 258 Score = 27.7 bits (60), Expect = 7.6 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +3 Query: 180 GWWLLHEMVGTFQTVV-GDG 236 GWW L E++GTF ++ G+G Sbjct: 10 GWWFLAELIGTFILIIFGNG 29 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,547,707 Number of Sequences: 219361 Number of extensions: 802995 Number of successful extensions: 1602 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1602 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)