| Clone Name | rbags24k09 |
|---|---|
| Clone Library Name | barley_pub |
>NPP_HORVU (Q687E1) Nucleotide pyrophosphatase/phosphodiesterase (EC 3.-.-.-)| (Fragments) Length = 368 Score = 143 bits (361), Expect = 9e-35 Identities = 66/66 (100%), Positives = 66/66 (100%) Frame = -3 Query: 399 AIPKWSIFRDHDYGFTKLTAFNHSSLLFEYMKSSDGKVYDSFTIHRDYRDVLSCVHDSCF 220 AIPKWSIFRDHDYGFTKLTAFNHSSLLFEYMKSSDGKVYDSFTIHRDYRDVLSCVHDSCF Sbjct: 303 AIPKWSIFRDHDYGFTKLTAFNHSSLLFEYMKSSDGKVYDSFTIHRDYRDVLSCVHDSCF 362 Query: 219 PTTLAS 202 PTTLAS Sbjct: 363 PTTLAS 368
>PPA_ASPFI (Q12546) Acid phosphatase precursor (EC 3.1.3.2) (pH 6-optimum acid| phosphatase) (APase6) Length = 614 Score = 37.7 bits (86), Expect = 0.007 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = -3 Query: 363 YGFTKLTAFNHSSLLFEYMKSSDGKVYDSFTI 268 YGF+KLT FN ++L +E ++ DG V DS T+ Sbjct: 569 YGFSKLTIFNETALKWELIRGDDGTVGDSLTL 600
>DSCAM_HUMAN (O60469) Down syndrome cell adhesion molecule precursor (CHD2)| Length = 2012 Score = 28.9 bits (63), Expect = 3.1 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 351 KLTAFNHSSLLFEYMKSSDGKVYDSF 274 ++T NH +L+ ++M SDG Y F Sbjct: 361 RITGINHENLIMDHMVKSDGGAYQCF 386
>XRCC2_HUMAN (O43543) DNA-repair protein XRCC2 (X-ray repair cross-complementing| protein 2) Length = 280 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = +3 Query: 63 THLLHDLFTSTYKLCS*P---ILLLNTCPQFYWMD 158 THLL L++ CS P +L+L++ FYW+D Sbjct: 124 THLLLTLYSLESMFCSHPSLCLLILDSLSAFYWID 158
>GBLP_DROME (O18640) Guanine nucleotide-binding protein beta subunit-like| protein (Receptor of activated protein kinase C homolog) Length = 318 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 387 WSIFRDHD--YGFTKLTAFNHSSLLFEYMKSSDG 292 W + RD D YG+ + + HS + + + SSDG Sbjct: 43 WKLTRDEDTNYGYPQKRLYGHSHFISDVVLSSDG 76
>YPEV_LACDL (P45495) Hypothetical transport protein in pepV 3'region (ORF2)| (Fragment) Length = 175 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +1 Query: 79 IFLLAHINCAADQFYYSTHAHNFIGWMTLHYIDMTAGRY 195 +F + + FY+ +++H F+ ++T Y+ AGR+ Sbjct: 60 LFFFFLLRALGEMFYFDSNSHTFVSFIT-RYLGEAAGRF 97
>RP1_MOUSE (P56716) Oxygen-regulated protein 1 (Retinitis pigmentosa RP1 protein| homolog) Length = 2095 Score = 27.7 bits (60), Expect = 6.8 Identities = 19/83 (22%), Positives = 37/83 (44%) Frame = -3 Query: 387 WSIFRDHDYGFTKLTAFNHSSLLFEYMKSSDGKVYDSFTIHRDYRDVLSCVHDSCFPTTL 208 WS + + G + + N L + +S +G +YDS+ L +HD+C + Sbjct: 964 WSGNTNQETGKSLVAKDNGEELNKHHCESQNGSLYDSY---------LVSLHDNCTLSQT 1014 Query: 207 AS*LISSGRHVNVMEGHPSNKIV 139 S+ H+++ + P K+V Sbjct: 1015 TINEPSTKSHLSIEKSRPEVKLV 1037 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,048,087 Number of Sequences: 219361 Number of extensions: 931147 Number of successful extensions: 2550 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2550 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)