ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags24i08 |
|---|---|
| Clone Library Name | barley_pub |
>COX12_SCHPO (O94581) Cytochrome c oxidase polypeptide VIb (EC 1.9.3.1)| Length = 83 Score = 42.4 bits (98), Expect = 3e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 348 CXSEWVERWNEQRENGTFP 292 C EWVERW+EQRENGTFP Sbjct: 62 CPMEWVERWDEQRENGTFP 80
>CX6B2_RAT (Q6YFQ1) Cytochrome c oxidase subunit VIb isoform 2 (EC 1.9.3.1)| (COX VIb-2) (Cytochrome c oxidase subunit VIb, testis-specific isoform) Length = 88 Score = 33.9 bits (76), Expect = 0.10 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 348 CXSEWVERWNEQRENGTFP 292 C WV+RWNEQ + GTFP Sbjct: 67 CPVSWVQRWNEQIKQGTFP 85
>CX6B2_MOUSE (Q80ZN9) Cytochrome c oxidase subunit VIb isoform 2 (EC 1.9.3.1)| (COX VIb-2) (Cytochrome c oxidase subunit VIb, testis-specific isoform) Length = 88 Score = 33.9 bits (76), Expect = 0.10 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 348 CXSEWVERWNEQRENGTFP 292 C WV+RWNEQ + GTFP Sbjct: 67 CPISWVQRWNEQIKQGTFP 85
>CX6B1_PONPY (Q5RCT0) Cytochrome c oxidase subunit VIb isoform 1 (EC 1.9.3.1)| (COX VIb-1) Length = 85 Score = 31.6 bits (70), Expect = 0.51 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 348 CXSEWVERWNEQRENGTFP 292 C + WV W+EQR GTFP Sbjct: 64 CPTSWVTDWDEQRAEGTFP 82
>CX6B1_MACMU (Q53CG4) Cytochrome c oxidase subunit VIb isoform 1 (EC 1.9.3.1)| (COX VIb-1) Length = 86 Score = 31.6 bits (70), Expect = 0.51 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 348 CXSEWVERWNEQRENGTFP 292 C + WV W+EQR GTFP Sbjct: 65 CPTSWVTDWDEQRAEGTFP 83
>CX6B1_MACFA (Q4R374) Cytochrome c oxidase subunit VIb isoform 1 (EC 1.9.3.1)| (COX VIb-1) Length = 86 Score = 31.6 bits (70), Expect = 0.51 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 348 CXSEWVERWNEQRENGTFP 292 C + WV W+EQR GTFP Sbjct: 65 CPTSWVTDWDEQRAEGTFP 83
>CX6B1_HUMAN (P14854) Cytochrome c oxidase subunit VIb isoform 1 (EC 1.9.3.1)| (COX VIb-1) Length = 85 Score = 31.6 bits (70), Expect = 0.51 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 348 CXSEWVERWNEQRENGTFP 292 C + WV W+EQR GTFP Sbjct: 64 CPTSWVTDWDEQRAEGTFP 82
>COX12_YEAST (Q01519) Cytochrome c oxidase polypeptide VIb (EC 1.9.3.1) (AED)| Length = 82 Score = 30.8 bits (68), Expect = 0.86 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -1 Query: 348 CXSEWVERWNEQRENGTF 295 C +W+E+W++QRE G F Sbjct: 58 CPLDWIEKWDDQREKGIF 75
>SMAL1_MOUSE (Q8BJL0) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A-like protein 1 (EC 3.6.1.-) (Sucrose nonfermenting protein 2-like 1) (HepA-related protein) (mharp) Length = 910 Score = 30.8 bits (68), Expect = 0.86 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = -3 Query: 328 ALERATGEWHIPXNPVSFSGAGRTNIPSSPPTSLVTGQSYFVPRIR 191 A+ER + P + S G+T++PS+P + VTG+ + R+R Sbjct: 256 AVERLSTVSLKPLDEAGGSVGGQTSLPSAPSLTFVTGKCMLISRVR 301
>CX6B2_HUMAN (Q6YFQ2) Cytochrome c oxidase subunit VIb isoform 2 (EC 1.9.3.1)| (COX VIb-2) (Cytochrome c oxidase subunit VIb, testis-specific isoform) Length = 88 Score = 30.0 bits (66), Expect = 1.5 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 348 CXSEWVERWNEQRENGTF 295 C WVE WNEQ +NG F Sbjct: 67 CPISWVESWNEQIKNGIF 84
>CX6B2_BOVIN (Q6YFP9) Cytochrome c oxidase subunit VIb isoform 2 (EC 1.9.3.1)| (COX VIb-2) (Cytochrome c oxidase subunit VIb, testis-specific isoform) Length = 88 Score = 29.3 bits (64), Expect = 2.5 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 348 CXSEWVERWNEQRENGTF 295 C WV+RW EQ ++GTF Sbjct: 67 CPISWVQRWKEQIKDGTF 84
>SUZ2_DROME (P25172) Protein suppressor 2 of zeste (Protein posterior sex combs)| Length = 1368 Score = 29.3 bits (64), Expect = 2.5 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 8/55 (14%) Frame = +3 Query: 45 KQQVQSNSKGGRCTKSSE*SLGETDGQHLQ--------LTSSQKLICK*SSKRKG 185 KQ + +NS GG T S S G T+G LQ T+ +K+ K +S G Sbjct: 1113 KQNISANSNGGPSTTSGSNSNGTTNGDDLQNLHMLSESATAREKISIKAASSGNG 1167
>RS2_BACSU (P21464) 30S ribosomal protein S2 (BS1) (Vegetative protein 209)| (VEG209) Length = 245 Score = 28.9 bits (63), Expect = 3.3 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +1 Query: 25 DLNRVTQNSKFSQIPKVDVVQ-NPVNDRWEKLMGSTFSLHQVKN-LFVSSPQK 177 D+ ++ +N F +PK +VVQ +R EK +G + + + LF+ P+K Sbjct: 115 DIEKMQENGTFDVLPKKEVVQLKKELERLEKFLGGIKDMKDLPDALFIIDPRK 167
>AGUA_LEGPA (Q5X986) Putative agmatine deiminase (EC 3.5.3.12) (Agmatine| iminohydrolase) Length = 346 Score = 28.5 bits (62), Expect = 4.3 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +1 Query: 73 VDVVQNPVNDRWEKLMGSTFSLHQVKNL 156 ++++ P+ND W + G+TF ++ K L Sbjct: 79 IEIISLPINDSWTRDTGATFLINNEKQL 106
>CX6B1_TARSY (Q7YRK6) Cytochrome c oxidase subunit VIb isoform 1 (EC 1.9.3.1)| (COX VIb-1) Length = 85 Score = 28.5 bits (62), Expect = 4.3 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 348 CXSEWVERWNEQRENGTFP 292 C WV W+++R GTFP Sbjct: 64 CPISWVSTWDDRRAEGTFP 82
>CX6B1_BOVIN (P00429) Cytochrome c oxidase subunit VIb isoform 1 (EC 1.9.3.1)| (COX VIb-1) (Cytochrome c oxidase polypeptide VII) (Cytochrome c oxidase subunit AED) Length = 85 Score = 28.5 bits (62), Expect = 4.3 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 348 CXSEWVERWNEQRENGTFP 292 C WV W+++R GTFP Sbjct: 64 CPISWVSTWDDRRAEGTFP 82
>TRFE_PAROL (O93429) Serotransferrin precursor| Length = 685 Score = 28.5 bits (62), Expect = 4.3 Identities = 20/76 (26%), Positives = 32/76 (42%) Frame = +1 Query: 1 LLCNQNDXDLNRVTQNSKFSQIPKVDVVQNPVNDRWEKLMGSTFSLHQVKNLFVSSPQKG 180 LLC N +N +++P VV N+ + + + S + NLF S+P G Sbjct: 232 LLCKDNTRKPIDQFENCDLAKVPSHAVVTRKDNEELAQFIWQSLSSVKNFNLFSSTPYGG 291 Query: 181 KGSGEFSAQSNFVQSP 228 K + + VQ P Sbjct: 292 KNLMFKDSTTTLVQLP 307
>BAGS_BOMMO (Q9BLJ6) BAG domain-containing protein Samui| Length = 677 Score = 27.7 bits (60), Expect = 7.3 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 7 CNQNDXDLNRVTQNSKFSQIPKVDVVQN 90 C +D D+ TQN + ++IP +V+N Sbjct: 478 CQSHDVDMKENTQNDQTTEIPAQPIVEN 505
>RS2_BACHK (Q6HEY8) 30S ribosomal protein S2| Length = 233 Score = 27.7 bits (60), Expect = 7.3 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +1 Query: 25 DLNRVTQNSKFSQIPKVDVVQ-NPVNDRWEKLMGSTFSLHQVKN-LFVSSPQK 177 D+ R+ ++ F +PK +VVQ +R EK +G + + + LFV P+K Sbjct: 116 DIERMQEDGTFEVLPKKEVVQLKKELERLEKFLGGIKDMKGLPSALFVVDPRK 168
>RS2_BACCZ (Q636J9) 30S ribosomal protein S2| Length = 233 Score = 27.7 bits (60), Expect = 7.3 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +1 Query: 25 DLNRVTQNSKFSQIPKVDVVQ-NPVNDRWEKLMGSTFSLHQVKN-LFVSSPQK 177 D+ R+ ++ F +PK +VVQ +R EK +G + + + LFV P+K Sbjct: 116 DIERMQEDGTFEVLPKKEVVQLKKELERLEKFLGGIKDMKGLPSALFVVDPRK 168
>RS2_BACCR (Q819X9) 30S ribosomal protein S2| Length = 233 Score = 27.7 bits (60), Expect = 7.3 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +1 Query: 25 DLNRVTQNSKFSQIPKVDVVQ-NPVNDRWEKLMGSTFSLHQVKN-LFVSSPQK 177 D+ R+ ++ F +PK +VVQ +R EK +G + + + LFV P+K Sbjct: 116 DIERMQEDGTFEVLPKKEVVQLKKELERLEKFLGGIKDMKGLPSALFVVDPRK 168
>RS2_BACC1 (Q9XBK3) 30S ribosomal protein S2| Length = 233 Score = 27.7 bits (60), Expect = 7.3 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +1 Query: 25 DLNRVTQNSKFSQIPKVDVVQ-NPVNDRWEKLMGSTFSLHQVKN-LFVSSPQK 177 D+ R+ ++ F +PK +VVQ +R EK +G + + + LFV P+K Sbjct: 116 DIERMQEDGTFEVLPKKEVVQLKKELERLEKFLGGIKDMKGLPSALFVVDPRK 168
>RS2_BACAN (Q81WK8) 30S ribosomal protein S2| Length = 233 Score = 27.7 bits (60), Expect = 7.3 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +1 Query: 25 DLNRVTQNSKFSQIPKVDVVQ-NPVNDRWEKLMGSTFSLHQVKN-LFVSSPQK 177 D+ R+ ++ F +PK +VVQ +R EK +G + + + LFV P+K Sbjct: 116 DIERMQEDGTFEVLPKKEVVQLKKELERLEKFLGGIKDMKGLPSALFVVDPRK 168
>AGUA_LEGPL (Q5X0L4) Putative agmatine deiminase (EC 3.5.3.12) (Agmatine| iminohydrolase) Length = 347 Score = 27.3 bits (59), Expect = 9.5 Identities = 8/28 (28%), Positives = 18/28 (64%) Frame = +1 Query: 73 VDVVQNPVNDRWEKLMGSTFSLHQVKNL 156 ++++ P+ND W + G+TF ++ + L Sbjct: 79 IEIISLPINDSWTRDTGATFLINNERQL 106
>AGUA_LEGPH (Q5ZZK4) Putative agmatine deiminase (EC 3.5.3.12) (Agmatine| iminohydrolase) Length = 348 Score = 27.3 bits (59), Expect = 9.5 Identities = 8/28 (28%), Positives = 18/28 (64%) Frame = +1 Query: 73 VDVVQNPVNDRWEKLMGSTFSLHQVKNL 156 ++++ P+ND W + G+TF ++ + L Sbjct: 81 IEIISLPINDSWTRDTGATFLINNERQL 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,060,341 Number of Sequences: 219361 Number of extensions: 1005903 Number of successful extensions: 2405 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 2366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2405 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
