| Clone Name | rbags24h10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ARPC1_SCHPO (P78774) Probable ARP2/3 complex 41 kDa subunit (p41... | 28 | 4.8 |
|---|
>ARPC1_SCHPO (P78774) Probable ARP2/3 complex 41 kDa subunit (p41-ARC)| Length = 377 Score = 28.5 bits (62), Expect = 4.8 Identities = 15/56 (26%), Positives = 24/56 (42%) Frame = +1 Query: 13 KXSRESLGTPIWQPANAILSKPYTRRPQFAFSAQSNWLEIISAGTGTKQECFTQSG 180 K S+ L + +W +AI++ Y P +S W GT + FT +G Sbjct: 248 KLSQLPLRSLLWANESAIVAAGYNYSPILLQGNESGWAHTRDLDAGTSKTSFTHTG 303 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,633,244 Number of Sequences: 219361 Number of extensions: 580780 Number of successful extensions: 1308 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1308 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)