| Clone Name | rbags24g20 |
|---|---|
| Clone Library Name | barley_pub |
>PMGI_PRUDU (O24246) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (PGAM-I) (Fragment) Length = 488 Score = 47.0 bits (110), Expect = 1e-05 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -3 Query: 309 TVXNLHGFQAPADYETTLIEVVD 241 TV NLHGF+APADYETTLIEVVD Sbjct: 465 TVMNLHGFEAPADYETTLIEVVD 487
>PMGI_MAIZE (P30792) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (PGAM-I) Length = 559 Score = 43.1 bits (100), Expect = 2e-04 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -3 Query: 309 TVXNLHGFQAPADYETTLIEVVD 241 TV NLHGF+APADYE TLIEV D Sbjct: 536 TVMNLHGFEAPADYEQTLIEVAD 558
>PMG2_ARATH (Q9M9K1) Probable 2,3-bisphosphoglycerate-independent| phosphoglycerate mutase 2 (EC 5.4.2.1) (Phosphoglyceromutase 2) (BPG-independent PGAM 2) (PGAM-I 2) Length = 560 Score = 43.1 bits (100), Expect = 2e-04 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = -3 Query: 309 TVXNLHGFQAPADYETTLIEVVDK 238 TV NLHGF AP+DYET+LIEVV+K Sbjct: 537 TVMNLHGFVAPSDYETSLIEVVEK 560
>PMGI_RICCO (P35493) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (PGAM-I) Length = 556 Score = 42.0 bits (97), Expect = 4e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 309 TVXNLHGFQAPADYETTLIEVVD 241 TV NLHGF+AP+DYE TLIE VD Sbjct: 533 TVMNLHGFEAPSDYEPTLIEAVD 555
>PMGI_MESCR (Q42908) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (PGAM-I) Length = 559 Score = 41.2 bits (95), Expect = 7e-04 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 309 TVXNLHGFQAPADYETTLIEVV 244 TV NLHGF+AP+DYE TLIEVV Sbjct: 536 TVMNLHGFEAPSDYEPTLIEVV 557
>PMG1_ARATH (O04499) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase 1 (EC 5.4.2.1) (Phosphoglyceromutase 1) (BPG-independent PGAM 1) (PGAM-I 1) Length = 557 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 309 TVXNLHGFQAPADYETTLIEVVD 241 TV NLHGF AP+DYE TLIEVV+ Sbjct: 535 TVMNLHGFVAPSDYEPTLIEVVE 557
>PMGI_TOBAC (P35494) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (PGAM-I) Length = 559 Score = 37.0 bits (84), Expect = 0.013 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -3 Query: 309 TVXNLHGFQAPADYETTLIEVVD 241 T NLHG +AP+DYE +LIEVVD Sbjct: 536 TFMNLHGSEAPSDYEPSLIEVVD 558
>YOPB_YERPS (Q06114) Protein yopB| Length = 401 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -3 Query: 201 GSQFCRYSFGVGQGMIASLNNLRFASTLAQNSCVTLRKVD 82 GSQ + + GVG G+ ++NN + A N+ + L K D Sbjct: 312 GSQATQVAVGVGSGITQTINNKKQADLQHNNADLALNKAD 351
>YOPB_YEREN (P37131) Protein yopB| Length = 401 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -3 Query: 201 GSQFCRYSFGVGQGMIASLNNLRFASTLAQNSCVTLRKVD 82 GSQ + + GVG G+ ++NN + A N+ + L K D Sbjct: 312 GSQATQVAVGVGSGITQTINNKKQADLQHNNADLALNKAD 351
>NEP1_NEPGR (Q766C3) Aspartic proteinase nepenthesin-1 precursor (EC 3.4.23.-)| (Nepenthesin-I) Length = 437 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 222 AL*SQNCGSQFCRYSFGVGQG 160 AL S C + FC+Y++G G G Sbjct: 157 ALSSPTCSNNFCQYTYGYGDG 177 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,127,741 Number of Sequences: 219361 Number of extensions: 723870 Number of successful extensions: 1491 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1491 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)