| Clone Name | rbags24g18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DBP10_YARLI (Q6C7X8) ATP-dependent RNA helicase DBP10 (EC 3.6.1.-) | 28 | 4.9 | 2 | DME_ARATH (Q8LK56) Transcriptional activator DEMETER (DNA glycos... | 28 | 8.3 |
|---|
>DBP10_YARLI (Q6C7X8) ATP-dependent RNA helicase DBP10 (EC 3.6.1.-)| Length = 926 Score = 28.5 bits (62), Expect = 4.9 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 Query: 46 VVPISKLPAPVTFSTRAGRTKSQHNLSWATWVPKTHDFSFEL 171 V+ S P+P F R GRT N WA + K +D + L Sbjct: 464 VINYSLPPSPKVFIHRVGRTARAGNRGWAYSIIKDNDIPYLL 505
>DME_ARATH (Q8LK56) Transcriptional activator DEMETER (DNA glycosylase-related| protein DME) Length = 1729 Score = 27.7 bits (60), Expect = 8.3 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 7/49 (14%) Frame = +2 Query: 8 YLGHKKLIFSGXRLFPSPSCLHQLL-----SQH--VLGAQNPNITYRGQ 133 +L H+ + +G +L+ SP+ +HQL+ QH ++ Q P RGQ Sbjct: 309 FLNHQTCLPAGNQLYGSPTDMHQLVMSTGGQQHGLLIKNQQPGSLIRGQ 357 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,365,989 Number of Sequences: 219361 Number of extensions: 550226 Number of successful extensions: 1363 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1363 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)