ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags24g08 |
|---|---|
| Clone Library Name | barley_pub |
>DHC3_HUMAN (O75828) Carbonyl reductase [NADPH] 3 (EC 1.1.1.184)| (NADPH-dependent carbonyl reductase 3) Length = 276 Score = 37.4 bits (85), Expect = 0.011 Identities = 19/33 (57%), Positives = 22/33 (66%) Frame = -1 Query: 162 PGYVKTDINFHTGDLTVEEGARGPVMLALIPKD 64 PG VKTD++ TVEEGA PV LAL+P D Sbjct: 227 PGPVKTDMDGKDSIRTVEEGAETPVYLALLPPD 259
>DHCA_RABIT (P47844) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184)| (NADPH-dependent carbonyl reductase 1) Length = 276 Score = 37.0 bits (84), Expect = 0.014 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = -1 Query: 162 PGYVKTDINFHTGDLTVEEGARGPVMLALIPKD--GPTGAY 46 PG+V+TD+ + EEGA PV LAL+P D GP G + Sbjct: 227 PGWVRTDMGGPNATKSPEEGAETPVYLALLPPDAEGPHGQF 267
>DHCA_PONPY (Q5RCU5) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184)| (NADPH-dependent carbonyl reductase 1) Length = 276 Score = 35.8 bits (81), Expect = 0.031 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = -1 Query: 162 PGYVKTDINFHTGDLTVEEGARGPVMLALIPKD--GPTGAY 46 PG+V+TD+ + EEGA PV LAL+P D GP G + Sbjct: 227 PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 267
>DHCA_MOUSE (P48758) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184)| (NADPH-dependent carbonyl reductase 1) Length = 276 Score = 35.8 bits (81), Expect = 0.031 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = -1 Query: 162 PGYVKTDINFHTGDLTVEEGARGPVMLALIPKD--GPTGAY 46 PG+V+TD+ + EEGA PV LAL+P D GP G + Sbjct: 227 PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 267
>DHCA_HUMAN (P16152) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184)| (NADPH-dependent carbonyl reductase 1) (Prostaglandin-E(2) 9-reductase) (EC 1.1.1.189) (Prostaglandin 9-ketoreductase) (15-hydroxyprostaglandin dehydrogenase [NADP+]) (EC 1.1.1.197) Length = 276 Score = 35.8 bits (81), Expect = 0.031 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = -1 Query: 162 PGYVKTDINFHTGDLTVEEGARGPVMLALIPKD--GPTGAY 46 PG+V+TD+ + EEGA PV LAL+P D GP G + Sbjct: 227 PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 267
>DHCA_PIG (Q28960) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184)| (NADPH-dependent carbonyl reductase 1) (20-beta-hydroxysteroid dehydrogenase) (Prostaglandin-E(2) 9-reductase) (EC 1.1.1.189) (Prostaglandin 9-ketoreductase) (15-hydroxyprostaglandin dehydroge Length = 288 Score = 34.3 bits (77), Expect = 0.089 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -1 Query: 162 PGYVKTDINFHTGDLTVEEGARGPVMLALIPKD--GPTGAY 46 PG+V+TD+ + E GA PV LAL+P D GP G + Sbjct: 227 PGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQF 267
>DHCA_RAT (P47727) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184)| (NADPH-dependent carbonyl reductase 1) Length = 276 Score = 34.3 bits (77), Expect = 0.089 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = -1 Query: 162 PGYVKTDINFHTGDLTVEEGARGPVMLALIP--KDGPTGAY 46 PG+V+TD+ + EEGA PV LAL+P +GP G + Sbjct: 227 PGWVRTDMAGPKATKSPEEGAETPVYLALLPPGAEGPHGQF 267
>SO4A1_RAT (Q99N01) Solute carrier organic anion transporter family member 4A1| (Solute carrier family 21 member 12) (Sodium-independent organic anion transporter E) (Organic anion-transporting polypeptide E) (OATP-E) Length = 723 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = -3 Query: 208 ILAKKHTSMRVNCLDAWIC*DRHQFPHRGSDRGGRRKRPCYAG 80 +L K ++ C + C RH P GSD G PCYAG Sbjct: 494 LLPKGQLDLKAACNALYCCQPRHYSPLCGSD-GTMYYSPCYAG 535
>PLXA1_HUMAN (Q9UIW2) Plexin-A1 precursor (Semaphorin receptor NOV)| Length = 1896 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +1 Query: 13 LQEGCFYCAVEVGSRRPILW----YECQHNRASCAFLHGQI 123 + + C C V P W + C HN A CAFL G++ Sbjct: 663 VHQSCLSC---VNGSFPCHWCKYRHVCTHNVADCAFLEGRV 700
>SMG1_DROME (Q70PP2) Serine/threonine-protein kinase Smg1 (EC 2.7.11.1)| Length = 3218 Score = 27.7 bits (60), Expect = 8.4 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 145 CLNISRHLSN*RALRCASWPEFLRKH 222 C N S+ +S+ +RC +W + LR+H Sbjct: 1252 CQNRSKFISSAILMRCLAWTQLLRQH 1277
>MRAY_CAMJR (Q5HW33) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 353 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 1 KIQWLQEGCFYCAVEVGSRRPILWYEC 81 KIQ L E CA +G+ LWY C Sbjct: 225 KIQGLGEVVIICAALIGALMGFLWYNC 251
>MRAY_CAMJE (Q9PI72) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 353 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 1 KIQWLQEGCFYCAVEVGSRRPILWYEC 81 KIQ L E CA +G+ LWY C Sbjct: 225 KIQGLGEVVIICAALIGALMGFLWYNC 251 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,721,620 Number of Sequences: 219361 Number of extensions: 694489 Number of successful extensions: 1902 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1725 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1902 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
