| Clone Name | rbags24g01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VE2_HPV11 (P04015) Regulatory protein E2 | 31 | 2.2 | 2 | PAR4_RAT (Q920E0) Proteinase-activated receptor 4 precursor (PAR... | 30 | 5.0 | 3 | PAR4_HUMAN (Q96RI0) Proteinase-activated receptor 4 precursor (P... | 30 | 6.5 | 4 | RL3_DEBHA (Q6BXM5) 60S ribosomal protein L3 | 30 | 6.5 | 5 | PAR4_MOUSE (O88634) Proteinase-activated receptor 4 precursor (P... | 29 | 8.5 |
|---|
>VE2_HPV11 (P04015) Regulatory protein E2| Length = 367 Score = 31.2 bits (69), Expect = 2.2 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = -2 Query: 391 SRVKNRSAAER--HVGYGAKTRFASEPTECFACSWSFWLFPPPACF 260 S K +A E H+ AKT++ EP S+ WL PP CF Sbjct: 65 SETKGHNAIEMQMHLESLAKTQYGVEPWTLQDTSYEMWLTPPKRCF 110
>PAR4_RAT (Q920E0) Proteinase-activated receptor 4 precursor (PAR-4)| (Thrombin receptor-like 3) (Coagulation factor II receptor-like 3) Length = 395 Score = 30.0 bits (66), Expect = 5.0 Identities = 13/24 (54%), Positives = 17/24 (70%), Gaps = 3/24 (12%) Frame = -3 Query: 285 GCFLPLLALFMCHG---RECVANG 223 GCF+PLLA+ +C+G R ANG Sbjct: 263 GCFVPLLAMVLCYGATLRALAANG 286
>PAR4_HUMAN (Q96RI0) Proteinase-activated receptor 4 precursor (PAR-4)| (Thrombin receptor-like 3) (Coagulation factor II receptor-like 3) Length = 385 Score = 29.6 bits (65), Expect = 6.5 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 285 GCFLPLLALFMCHG 244 GCFLPLLA+ +C+G Sbjct: 252 GCFLPLLAMLLCYG 265
>RL3_DEBHA (Q6BXM5) 60S ribosomal protein L3| Length = 389 Score = 29.6 bits (65), Expect = 6.5 Identities = 14/52 (26%), Positives = 28/52 (53%) Frame = -2 Query: 574 VHKVSSITERLAHMSVTSRTRTTVKPPVPLLKAGHLKSDFLGKSDEIPPAKR 419 V++V S + + + RT+ T+ P ++ G++K+DF+ IP K+ Sbjct: 282 VYRVGSAGDESSGATEFDRTKKTINPMGGFVRYGNVKNDFMLLKGSIPGVKK 333
>PAR4_MOUSE (O88634) Proteinase-activated receptor 4 precursor (PAR-4)| (Thrombin receptor-like 3) (Coagulation factor II receptor-like 3) Length = 396 Score = 29.3 bits (64), Expect = 8.5 Identities = 13/24 (54%), Positives = 17/24 (70%), Gaps = 3/24 (12%) Frame = -3 Query: 285 GCFLPLLALFMCHG---RECVANG 223 GCF+PLLA+ +C+G R ANG Sbjct: 264 GCFVPLLAMGLCYGATLRALAANG 287 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,021,314 Number of Sequences: 219361 Number of extensions: 1834063 Number of successful extensions: 5110 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4909 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5109 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)