| Clone Name | rbags24f12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CYSP_SALTY (P41031) Thiosulfate-binding protein precursor | 29 | 5.7 | 2 | CYSP_ECOLI (P16700) Thiosulfate-binding protein precursor | 29 | 5.7 | 3 | VL1_BPV3 (P50805) Major capsid protein L1 | 29 | 5.7 | 4 | ZSWM2_HUMAN (Q8NEG5) Zinc finger SWIM domain-containing protein 2 | 29 | 7.5 | 5 | HEM6_HUMAN (P36551) Coproporphyrinogen III oxidase, mitochondria... | 28 | 9.7 |
|---|
>CYSP_SALTY (P41031) Thiosulfate-binding protein precursor| Length = 338 Score = 29.3 bits (64), Expect = 5.7 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +3 Query: 231 PPFHSRWMLST--DFLTIFPSHAGSGKQ 308 PPF +W D LTI SHAGS KQ Sbjct: 45 PPFEQQWAKDNGGDKLTIKQSHAGSSKQ 72
>CYSP_ECOLI (P16700) Thiosulfate-binding protein precursor| Length = 338 Score = 29.3 bits (64), Expect = 5.7 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +3 Query: 231 PPFHSRWMLST--DFLTIFPSHAGSGKQ 308 PPF +W D LTI SHAGS KQ Sbjct: 45 PPFEQQWAKDNGGDKLTIKQSHAGSSKQ 72
>VL1_BPV3 (P50805) Major capsid protein L1| Length = 510 Score = 29.3 bits (64), Expect = 5.7 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = -2 Query: 423 WDNGYRITATAATLDQAAFILSIPRRKPNDETQETLRTSAFPS--QHVKEKWSKNLYL 256 W+N +TA +T F +S+ R KP+ E Q+T + F +HV E+W +L L Sbjct: 326 WNNQLFVTAVDSTRG-TNFTISVHRDKPSLEDQDTYTAAEFKHYLRHV-EEWEVSLVL 381
>ZSWM2_HUMAN (Q8NEG5) Zinc finger SWIM domain-containing protein 2| Length = 633 Score = 28.9 bits (63), Expect = 7.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 436 HPSTMG*WLSHHCNSCHIGPGCIY 365 H + WL H CNSC IG IY Sbjct: 367 HRKCIDNWLFHKCNSCPIGGQVIY 390
>HEM6_HUMAN (P36551) Coproporphyrinogen III oxidase, mitochondrial precursor| (EC 1.3.3.3) (Coproporphyrinogenase) (Coprogen oxidase) (COX) Length = 454 Score = 28.5 bits (62), Expect = 9.7 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +2 Query: 56 QSREAVTKSSVTGLPFVSLWVSKLVVLALQNHPFSS*KPAIHISSSYQEPTELNG 220 +SR V K+ LPF ++ VS ++ HP + P IH + Y E E +G Sbjct: 223 RSRGKVLKTKDGKLPFCAMGVSSVI------HPKNPHAPTIHFNYRYFEVEEADG 271 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,018,598 Number of Sequences: 219361 Number of extensions: 1281864 Number of successful extensions: 2682 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2639 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2681 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)