| Clone Name | rbags23p18 |
|---|---|
| Clone Library Name | barley_pub |
>PICA_DROME (Q9VI75) Phosphatidylinositol-binding clathrin assembly protein LAP| (Like-AP180) Length = 468 Score = 32.0 bits (71), Expect = 1.6 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = +3 Query: 309 IVSLLYMYFKRNRYHAHSALDA----LVSSDHLRTFLTSSTNCALLEGSI 446 I++LL YF N+ HA ALD LV D + FL + N + +G I Sbjct: 229 IINLLEKYFDMNKKHARDALDLYKKFLVRMDRVGEFLKVAENVGIDKGDI 278
>RBGPR_HUMAN (Q9H2M9) Rab3 GTPase-activating protein non-catalytic subunit (Rab3| GTPase-activating protein 150 kDa subunit) (Rab3-GAP p150) (Rab3-GAP regulatory subunit) (RAB3-GAP150) (RGAP-iso) Length = 1393 Score = 31.6 bits (70), Expect = 2.0 Identities = 30/94 (31%), Positives = 43/94 (45%), Gaps = 5/94 (5%) Frame = -2 Query: 622 STEWDDDDAFVAWREN-PENYQEYIKELRAQRVSQLLSDVADSSP--DLQ--ALPQGLSM 458 ST+W+D D + AW EN P+ +E + Q+ S L V SP DL A Q Sbjct: 41 STDWED-DGWGAWEENEPQEPEEEGNTCKTQKTSWLQDCVLSLSPTNDLMVIAREQKAVF 99 Query: 457 LLEKMDPSRRAQFVEEVKKVLK*SDDTNASNAEC 356 L+ K S + + EE++ + S N EC Sbjct: 100 LVPKWKYSDKGK--EEMQFAVGWSGSLNVEEGEC 131
>COIA1_MOUSE (P39061) Collagen alpha-1(XVIII) chain precursor [Contains:| Endostatin] Length = 1774 Score = 30.8 bits (68), Expect = 3.5 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +2 Query: 227 SSNNGRRLQTSFTKQWLTQISYGRLQPNSIPSIYVLQEKPISC--TFCIGCV 376 S +GRRL S+ + W T+ + Q +S+ S +L++K SC ++ + C+ Sbjct: 1713 SDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAASCHNSYIVLCI 1764
>CYSK2_SCHPO (P87131) Cysteine synthase 2 (EC 2.5.1.47) (O-acetylserine| sulfhydrylase 2) (O-acetylserine (Thiol)-lyase 2) (CSase 2) Length = 395 Score = 30.0 bits (66), Expect = 6.0 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -1 Query: 557 VYQRTQGSKGISVALRCCRL 498 VY+ T GS GIS+A+ CC L Sbjct: 108 VYEGTAGSTGISIAMLCCSL 127
>UBR1_HUMAN (Q8IWV7) Ubiquitin-protein ligase E3 component N-recognin-1 (EC| 6.-.-.-) (Ubiquitin-protein ligase E3-alpha-1) (Ubiquitin-protein ligase E3-alpha-I) Length = 1749 Score = 30.0 bits (66), Expect = 6.0 Identities = 17/64 (26%), Positives = 32/64 (50%) Frame = +3 Query: 336 KRNRYHAHSALDALVSSDHLRTFLTSSTNCALLEGSIFSSSIERPCGKACRSGLESATSE 515 K RY+ D S DH+ L + +C L E + +++I++ +A ++G +A E Sbjct: 222 KNERYYCVLFNDEHHSYDHVIYSLQRALDCELAEAQLHTTAIDKEGRRAVKAGAYAACQE 281 Query: 516 SN*D 527 + D Sbjct: 282 AKED 285 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,139,780 Number of Sequences: 219361 Number of extensions: 1901874 Number of successful extensions: 5336 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5317 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5881538857 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)