| Clone Name | rbags23p16 |
|---|---|
| Clone Library Name | barley_pub |
>DPNP_ORYSA (Q40639) 3'(2'),5'-bisphosphate nucleotidase (EC 3.1.3.7)| (3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase) (DPNPase) Length = 358 Score = 75.9 bits (185), Expect = 3e-14 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 255 LDFSKGRFLDVDTGIIATNKQLXPSLLKSVQEAIKEKSQAPSPL 124 LDFSKGRFLD+DTGIIATNKQL PSLLK+VQ+AIKE++QA SPL Sbjct: 315 LDFSKGRFLDLDTGIIATNKQLMPSLLKAVQDAIKEQNQAASPL 358
>DPNP1_ARATH (Q42546) SAL1 phosphatase (3'(2'),5'-bisphosphate nucleotidase 1)| (EC 3.1.3.7) (3'(2'),5'-bisphosphonucleoside 3'(2')-phosphohydrolase 1) (DPNPase 1) (Inositol-1,4-bisphosphate 1-phosphatase 1) (EC 3.1.3.57) (Inositol polyphosphate 1-phosphat Length = 353 Score = 52.4 bits (124), Expect = 3e-07 Identities = 23/40 (57%), Positives = 34/40 (85%) Frame = -1 Query: 255 LDFSKGRFLDVDTGIIATNKQLXPSLLKSVQEAIKEKSQA 136 LDFSKG++LD+DTGII N++L P LLK+V+++I E+ +A Sbjct: 311 LDFSKGKYLDLDTGIIVANEKLMPLLLKAVRDSIAEQEKA 350
>DPNP3_ARATH (Q8GY63) Probable SAL3 phosphatase (3'(2'),5'-bisphosphate| nucleotidase 3) (EC 3.1.3.7) (3'(2'),5'-bisphosphonucleoside 3'(2')-phosphohydrolase 3) (DPNPase 3) (Inositol-1,4-bisphosphate 1-phosphatase 3) (EC 3.1.3.57) (Inositol polyphosphate 1 Length = 357 Score = 46.2 bits (108), Expect = 2e-05 Identities = 20/39 (51%), Positives = 30/39 (76%) Frame = -1 Query: 255 LDFSKGRFLDVDTGIIATNKQLXPSLLKSVQEAIKEKSQ 139 LDFSKG++LD GI+ T ++L P LL +V+E+IKE+ + Sbjct: 308 LDFSKGKYLDYKRGIVVTTQKLLPRLLTAVRESIKEEEE 346
>DPNP2_ARATH (O49623) SAL2 phosphatase (3'(2'),5'-bisphosphate nucleotidase 2)| (EC 3.1.3.7) (3'(2'),5'-bisphosphonucleoside 3'(2')-phosphohydrolase 2) (DPNPase 2) (Inositol-1,4-bisphosphate 1-phosphatase 2) (EC 3.1.3.57) (Inositol polyphosphate 1-phosphat Length = 347 Score = 45.4 bits (106), Expect = 4e-05 Identities = 21/38 (55%), Positives = 31/38 (81%) Frame = -1 Query: 255 LDFSKGRFLDVDTGIIATNKQLXPSLLKSVQEAIKEKS 142 LDFSKG++L TGII T K+L P +LK+V+E+I+E++ Sbjct: 307 LDFSKGKYLAHKTGIIVTTKKLKPWILKAVRESIEEEN 344
>DPNP4_ARATH (Q84VY5) Probable SAL4 phosphatase (3'(2'),5'-bisphosphate| nucleotidase 4) (EC 3.1.3.7) (3'(2'),5'-bisphosphonucleoside 3'(2')-phosphohydrolase 4) (DPNPase 4) (Inositol-1,4-bisphosphate 1-phosphatase 4) (EC 3.1.3.57) (Inositol polyphosphate 1 Length = 345 Score = 42.0 bits (97), Expect = 4e-04 Identities = 18/37 (48%), Positives = 28/37 (75%) Frame = -1 Query: 255 LDFSKGRFLDVDTGIIATNKQLXPSLLKSVQEAIKEK 145 LDFS+G L+ TGI+ + K L P LLK+++E+I+E+ Sbjct: 299 LDFSRGNHLEHKTGIVVSTKNLMPRLLKAIRESIEEE 335
>HAL2_CANAL (P46594) Halotolerance protein HAL2 (Fragment)| Length = 105 Score = 27.7 bits (60), Expect = 8.1 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -1 Query: 255 LDFSKGRFLDVDTGIIATNKQLXPSLLKSVQEAIKEKS 142 L+F GR LD G+IA NK++ ++ +V E K + Sbjct: 66 LNFGNGRTLD-SKGVIAANKEIFDKVIDAVTEIRKSST 102 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,752,346 Number of Sequences: 219361 Number of extensions: 528686 Number of successful extensions: 963 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 963 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)