| Clone Name | rbags23p10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GR61A_DROME (Q9W0M2) Putative gustatory receptor 61a | 31 | 3.5 | 2 | LNT_BDEBA (P61032) Apolipoprotein N-acyltransferase (EC 2.3.1.-)... | 31 | 3.5 | 3 | AROC_CHLMU (Q9PK26) Chorismate synthase (EC 4.2.3.5) (5-enolpyru... | 30 | 6.0 |
|---|
>GR61A_DROME (Q9W0M2) Putative gustatory receptor 61a| Length = 436 Score = 30.8 bits (68), Expect = 3.5 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 149 LCTNFSTKLVAISNLAYRFCSARKYILCALS*AASTVQRHPQFKVFVW 292 LC S ++SN+ + C+ Y++C + A T RHP V+ W Sbjct: 291 LCELASLVEASMSNIVFVSCANNVYVICNQALAIFTKLRHPINYVYFW 338
>LNT_BDEBA (P61032) Apolipoprotein N-acyltransferase (EC 2.3.1.-) (ALP| N-acyltransferase) Length = 547 Score = 30.8 bits (68), Expect = 3.5 Identities = 30/94 (31%), Positives = 43/94 (45%), Gaps = 6/94 (6%) Frame = +2 Query: 170 KLVAISNLAYRFCSARKYILCALS*AASTVQRHPQFKVFVWEHTHTQKDYAEVEF----- 334 K+ A AY+ RK++ LS AA +Q++PQ + +W T DY + Sbjct: 256 KIYAEQGRAYQEVITRKFL--DLSFAA--MQKYPQTDILIWPET-AFPDYLDQHLLDRKH 310 Query: 335 -AIGIKGLFPLTHP*RPATGKYLSQAQAQES*ET 433 I I GL PL+ P TG Y +A E +T Sbjct: 311 AQILISGLQPLSRP--LITGAYSKDPKADEKQDT 342
>AROC_CHLMU (Q9PK26) Chorismate synthase (EC 4.2.3.5)| (5-enolpyruvylshikimate-3-phosphate phospholyase) Length = 357 Score = 30.0 bits (66), Expect = 6.0 Identities = 18/39 (46%), Positives = 20/39 (51%) Frame = +3 Query: 240 AKLLLRSKGTHNLKFLSGNTRTHKKTMPKLNLQLALKGY 356 AK +L S+G L FLSG KT PKL L K Y Sbjct: 139 AKKILSSQGIKTLAFLSGFGPLENKTYPKLTDPLIRKVY 177 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,527,076 Number of Sequences: 219361 Number of extensions: 1796534 Number of successful extensions: 3790 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3789 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5881538857 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)