| Clone Name | rbags24e05 |
|---|---|
| Clone Library Name | barley_pub |
>RIM15_YEAST (P43565) Serine/threonine-protein kinase RIM15 (EC 2.7.11.1)| Length = 1770 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 39 SLIQIIQSSTPPKVNPNTLSEPKMIRNKTLPKTRKRIN 152 SL+ I +SSTPP NP + ++R K+L + + N Sbjct: 1066 SLLDISRSSTPPLANPTNSNANNIMRRKSLTENKSFSN 1103
>LAX4_MEDTR (Q8L884) Auxin transporter-like protein 4 (AUX1-like protein 4)| (MtLAX4) Length = 482 Score = 28.9 bits (63), Expect = 3.3 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 7/56 (12%) Frame = -2 Query: 229 IYYAFPDSLLPHLTV-------GIRDSDIVIPWFILFLVFGRVLLRIIFGSDSVLG 83 +Y+AF D LL H G RD+ +++ F+ FG + F + V+G Sbjct: 287 VYWAFGDELLNHSNAFSLLPKNGFRDAAVILMLIHQFITFGFACTPLYFVWEKVIG 342
>TRPA1_MOUSE (Q8BLA8) Transient receptor potential cation channel subfamily A| member 1 (Ankyrin-like with transmembrane domains protein 1) Length = 1125 Score = 28.9 bits (63), Expect = 3.3 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +1 Query: 208 NRETHNRFITHISA*PSEWGLASGGGSHDSQCLRHGRH 321 +RETH F+ H A P + SG CL +G H Sbjct: 228 SRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAH 265
>Y082_SYNY3 (Q55803) Hypothetical UPF0004 protein slr0082| Length = 443 Score = 28.1 bits (61), Expect = 5.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 229 IYYAFPDSLLPHLTVGIRDSDIVIPWFIL 143 I+YA+P L P + IRD+ V+P+ L Sbjct: 230 IHYAYPTGLTPKVIEAIRDTPNVLPYLDL 258
>Y489_RICPR (Q9ZD57) Hypothetical protein RP489| Length = 288 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/46 (28%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = -2 Query: 217 FPDSLL--PHLTVGIRDSDIVIPWFILFLVFGRVLLRIIFGSDSVL 86 F D+LL P+L + I++ WF+ FL+ +++ +++G ++L Sbjct: 180 FADNLLYAPNLFIFFGTPVIILFWFVTFLLERSIIVLLVYGLANLL 225
>POLS_RUBV (P08564) Structural polyprotein [Contains: Spike glycoprotein E1;| Spike glycoprotein E2] (Fragment) Length = 522 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 223 YAFPDSLLPHLTVGIRDSDIVIPWFILFLVFGRVLLR 113 Y P + PH G RD +++PW ++F+V R R Sbjct: 59 YPLPRTGEPH---GTRDFVLLVPWVLIFMVCRRACRR 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,778,974 Number of Sequences: 219361 Number of extensions: 892035 Number of successful extensions: 1885 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1863 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1885 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)