| Clone Name | rbags24d22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRI17_HUMAN (Q9Y577) Tripartite motif protein 17 (Testis RING fi... | 28 | 6.3 |
|---|
>TRI17_HUMAN (Q9Y577) Tripartite motif protein 17 (Testis RING finger protein)| (RING finger protein 16) Length = 477 Score = 28.1 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 177 WEHGFNML*XMHFLLGMCRVSRYTLNNRIPRCP 79 WE G N+ + LG+CR + +R+P+CP Sbjct: 353 WEVGMNITGDALWALGVCR-DNVSRKDRVPKCP 384 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,420,039 Number of Sequences: 219361 Number of extensions: 634420 Number of successful extensions: 1260 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1234 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1259 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)