| Clone Name | rbaal1c07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YNB8_YEAST (P53976) Hypothetical 69.6 kDa protein in HDA1-PUB1 i... | 29 | 5.9 |
|---|
>YNB8_YEAST (P53976) Hypothetical 69.6 kDa protein in HDA1-PUB1 intergenic| region Length = 612 Score = 28.9 bits (63), Expect = 5.9 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +3 Query: 3 HNTMYTPSDRVQRLTVV-SRTTETCLQMQDHMMNATGLASTALLTDDKWPPPFHFFHMS 176 HN PS VQR S TT++ + + + + T ST+ W PP H H+S Sbjct: 167 HNRAMLPSSLVQRNNATTSPTTDSASENNESVPSLTSSVSTSSSVYSSWNPP-HSPHIS 224 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,637,155 Number of Sequences: 219361 Number of extensions: 1315094 Number of successful extensions: 3273 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3273 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)