| Clone Name | rbags23l21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TBP_TOBAC (P93348) TATA-box-binding protein (TATA-box factor) (T... | 30 | 4.3 | 2 | Y1549_METJA (Q58944) Hypothetical protein MJ1549 | 30 | 5.7 | 3 | GCSPB_AQUAE (O67740) Probable glycine dehydrogenase [decarboxyla... | 30 | 7.4 |
|---|
>TBP_TOBAC (P93348) TATA-box-binding protein (TATA-box factor) (TATA-binding| factor) (TATA sequence-binding protein) (TBP) (Transcription initiation factor TFIID TBP subunit) Length = 200 Score = 30.4 bits (67), Expect = 4.3 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +3 Query: 207 AKKGHHARLASRKSAGINQKIGTDAKIKE 293 AK ++LA+RK A I QK+G DAK K+ Sbjct: 84 AKSEQSSKLAARKYARIIQKLGFDAKFKD 112
>Y1549_METJA (Q58944) Hypothetical protein MJ1549| Length = 392 Score = 30.0 bits (66), Expect = 5.7 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 3/65 (4%) Frame = +3 Query: 351 KHVSMDPLPNPLPESACAK*G-AMRASNLTTQSATADVV-CGIVWKYT-IMSSRYELKLT 521 +H ++P+P+ E+ACA A+R + L S +DVV G V K T ++ + + Sbjct: 69 EHAGLNPIPSTRVEAACASGSLALRQAVLNVASGASDVVLVGGVEKMTDVVDATSAISSA 128 Query: 522 ADELW 536 +D+ W Sbjct: 129 SDQEW 133
>GCSPB_AQUAE (O67740) Probable glycine dehydrogenase [decarboxylating] subunit 2| (EC 1.4.4.2) (Glycine decarboxylase subunit 2) (Glycine cleavage system P-protein subunit 2) Length = 482 Score = 29.6 bits (65), Expect = 7.4 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +3 Query: 345 YLKHVSMDPLPNPLPESACAK*GAMRASNLTTQSATADVVCGIVWKY 485 YLKH+ +P PES C + A+NLT A V + Y Sbjct: 355 YLKHLLKGVFKDPYPESPCMHEFVLSATNLTKYGVRASDVAKRILDY 401 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,260,809 Number of Sequences: 219361 Number of extensions: 1844629 Number of successful extensions: 4339 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4189 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4338 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)