| Clone Name | rbags23k22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DRTS2_ARATH (Q05763) Bifunctional dihydrofolate reductase-thymid... | 33 | 0.90 | 2 | UROL1_MOUSE (Q5DID3) Uromodulin-like 1 precursor (Olfactorin) | 30 | 5.8 | 3 | TRPE_BACCA (P30526) Anthranilate synthase component 1 (EC 4.1.3.... | 29 | 10.0 |
|---|
>DRTS2_ARATH (Q05763) Bifunctional dihydrofolate reductase-thymidylate synthase| 2 (DHFR-TS 2) [Includes: Dihydrofolate reductase (EC 1.5.1.3); Thymidylate synthase (EC 2.1.1.45)] Length = 518 Score = 32.7 bits (73), Expect = 0.90 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 379 TCNVLTSTEKNLRLPCEGVVQSVARSAYPPATPSIYICSTGNRMNFS 519 +C + TE + + C+ + +V SAY P S IC G R +F+ Sbjct: 145 SCEAIHITEIDTSIDCDTFIPTVDTSAYQPWCSSFPICENGLRFSFT 191
>UROL1_MOUSE (Q5DID3) Uromodulin-like 1 precursor (Olfactorin)| Length = 1319 Score = 30.0 bits (66), Expect = 5.8 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 433 VVQSVARSAYPPATPSI-YICSTGNRMNFSRCHWLFLGMEYL 555 ++ S+ SA P P++ Y+ STG + F+ WL +G L Sbjct: 197 LLYSLVTSALQPLNPAVHYLTSTGGKDTFTTVSWLLMGFPRL 238
>TRPE_BACCA (P30526) Anthranilate synthase component 1 (EC 4.1.3.27)| (Anthranilate synthase component I) Length = 508 Score = 29.3 bits (64), Expect = 10.0 Identities = 12/48 (25%), Positives = 24/48 (50%) Frame = +1 Query: 97 DCSNKNLKKVQRLACTSKVQMLQLGKRAHARIIASDTASALNERIHPI 240 D + ++ +V + +LQ+GK +H + S L++ +HPI Sbjct: 350 DLARNDIGRVAKYGTVEVPVLLQIGKFSHVMHLISKVVGELDDNVHPI 397 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,240,893 Number of Sequences: 219361 Number of extensions: 1758817 Number of successful extensions: 4109 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4109 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5767334219 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)