| Clone Name | rbags23j09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PLMN_SHEEP (P81286) Plasminogen (EC 3.4.21.7) (Fragment) | 32 | 1.6 | 2 | CO6A3_HUMAN (P12111) Collagen alpha-3(VI) chain precursor | 31 | 2.1 | 3 | PLMN_BOVIN (P06868) Plasminogen precursor (EC 3.4.21.7) [Contain... | 31 | 2.8 | 4 | NAPA_SYMTH (Q67QZ1) Periplasmic nitrate reductase precursor (EC ... | 30 | 6.2 | 5 | PROP_HUMAN (P27918) Properdin precursor (Factor P) | 29 | 8.1 |
|---|
>PLMN_SHEEP (P81286) Plasminogen (EC 3.4.21.7) (Fragment)| Length = 343 Score = 31.6 bits (70), Expect = 1.6 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +2 Query: 392 TPNCA*ESSSPLLCLSKTSPRRRSGRSWYLG*SSDPGPPS--FRISCQTPWCQE 547 T +C +S PL+C K + SW LG + P P R+S PW +E Sbjct: 286 TDSCQGDSGGPLVCFEKDKYILQGVTSWGLG-CARPNKPGVYVRVSTYVPWIEE 338
>CO6A3_HUMAN (P12111) Collagen alpha-3(VI) chain precursor| Length = 3176 Score = 31.2 bits (69), Expect = 2.1 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = +3 Query: 231 NNATCSPPWTTKHSTR*CTADPYKANYPVNTT*TKPLINTEKPIEVDETSSSIIHQ-TVR 407 NN T SP T++P PV TT KP+ T KP+ +II+Q +V+ Sbjct: 2860 NNVTSSP-----------TSNPVTTTKPVTTT--KPVTTTTKPVTTTTKPVTIINQPSVK 2906 Query: 408 EKAALPCYA 434 AA P A Sbjct: 2907 PAAAKPAPA 2915
>PLMN_BOVIN (P06868) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 812 Score = 30.8 bits (68), Expect = 2.8 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +2 Query: 392 TPNCA*ESSSPLLCLSKTSPRRRSGRSWYLG*SSDPGPPS--FRISCQTPWCQE 547 T +C +S PL+C K + SW LG + P P R+S PW +E Sbjct: 755 TDSCQGDSGGPLVCFEKDKYILQGVTSWGLG-CARPNKPGVYVRVSPYVPWIEE 807
>NAPA_SYMTH (Q67QZ1) Periplasmic nitrate reductase precursor (EC 1.7.99.4)| Length = 754 Score = 29.6 bits (65), Expect = 6.2 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 4/54 (7%) Frame = -2 Query: 549 YS*HHGVWQEIRKLGGPGSD-DYPKYHDRPDLLRGL---VFDKHSRGELLSHAQ 400 Y+ + +W+E RK+GG G+ DY Y +R RGL V DK G L + + Sbjct: 544 YTSNEVIWEEFRKMGGGGTGYDYAPY-ERYKQERGLRWPVNDKQPAGTTLRYVE 596
>PROP_HUMAN (P27918) Properdin precursor (Factor P)| Length = 469 Score = 29.3 bits (64), Expect = 8.1 Identities = 23/69 (33%), Positives = 26/69 (37%), Gaps = 1/69 (1%) Frame = -3 Query: 257 PWR*TCCIISCSLCP-EPLSDGSYSCS*A*TM*VWLSTHTVKPEAKAC*LLSWSDRDCNG 81 PW T C SC P EP S CS + KP K C L++ R C G Sbjct: 201 PW--TPCSASCHGGPHEPKETRSRKCS--------APEPSQKPPGKPCPGLAYEQRRCTG 250 Query: 80 LAHCKAVTG 54 L C G Sbjct: 251 LPPCPVAGG 259 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,475,889 Number of Sequences: 219361 Number of extensions: 1721592 Number of successful extensions: 3486 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3481 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)