| Clone Name | rbags23i24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RNS3_STRAU (P30289) Guanyl-specific ribonuclease Sa3 precursor (... | 30 | 6.0 | 2 | YB88_YEAST (P38330) Protein YBR238C | 30 | 7.8 |
|---|
>RNS3_STRAU (P30289) Guanyl-specific ribonuclease Sa3 precursor (EC 3.1.27.3)| (RNase Sa3) Length = 141 Score = 30.0 bits (66), Expect = 6.0 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -2 Query: 570 VPARTTGWYCNYVEVTATGPHMGCAQQLFTVEQW 469 +PA +TG+Y Y +T P G A+++ T +QW Sbjct: 89 LPAHSTGYYHEYTVITPGSPTRG-ARRIITGQQW 121
>YB88_YEAST (P38330) Protein YBR238C| Length = 731 Score = 29.6 bits (65), Expect = 7.8 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 223 NNRNWPAKTNHAHRSNRTTNSRSYFYNNNNMSH 321 NN N A+ N + +N N+R++ +NNN H Sbjct: 83 NNNNHLAQNNSNNSNNHHNNNRNHHHNNNRNHH 115 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,349,899 Number of Sequences: 219361 Number of extensions: 1117122 Number of successful extensions: 3097 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3045 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5881538857 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)