ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal1b12 |
|---|---|
| Clone Library Name | barley_pub |
>VSR3_ARATH (O80977) Vacuolar sorting receptor 3 precursor (AtVSR3) (Epidermal| growth factor receptor-like protein 2a) (AtELP2a) (BP80-like protein a') (AtBP80a') Length = 628 Score = 50.4 bits (119), Expect = 1e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 323 KYRIRRYMDSEIRAIMAQYMPLENXGDIHSH 231 KYR+R+YMDSEIRAIMAQYMPL++ +I +H Sbjct: 592 KYRLRQYMDSEIRAIMAQYMPLDSQPEIPNH 622
>VSR4_ARATH (Q56ZQ3) Vacuolar sorting receptor 4 precursor (AtVSR4) (Epidermal| growth factor receptor-like protein 2b) (AtELP2b) (BP80-like protein a) (AtBP80a) Length = 628 Score = 50.1 bits (118), Expect = 1e-06 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -2 Query: 323 KYRIRRYMDSEIRAIMAQYMPLENXGDIHSH 231 KYR+R+YMDSEIRAIMAQYMPL++ ++ +H Sbjct: 592 KYRLRQYMDSEIRAIMAQYMPLDSQPEVPNH 622
>VSR2_ARATH (O22925) Vacuolar sorting receptor 2 precursor (AtVSR2) (Epidermal| growth factor receptor-like protein 4) (AtELP4) (BP80-like protein c) (AtBP80c) Length = 625 Score = 48.5 bits (114), Expect = 4e-06 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -2 Query: 323 KYRIRRYMDSEIRAIMAQYMPLEN 252 KYRIR YMDSEIRAIMAQYMPL+N Sbjct: 590 KYRIRTYMDSEIRAIMAQYMPLDN 613
>VSR1_PEA (P93484) Vacuolar sorting receptor 1 precursor (BP-80) (80 kDa| proaleurein-binding protein) Length = 623 Score = 48.1 bits (113), Expect = 5e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -2 Query: 323 KYRIRRYMDSEIRAIMAQYMPLENXGDIHSH 231 KYRIR+YMDSEIRAIMAQYMPL++ + +H Sbjct: 587 KYRIRQYMDSEIRAIMAQYMPLDSQEEGPNH 617
>VSR1_ARATH (P93026) Vacuolar sorting receptor 1 precursor (AtVSR1) (Epidermal| growth factor receptor-like protein 1) (AtELP1) (AtELP) (BP80-like protein b) (AtBP80b) (Spot 3 protein) Length = 623 Score = 45.1 bits (105), Expect = 5e-05 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -2 Query: 323 KYRIRRYMDSEIRAIMAQYMPLEN 252 KYRIR YMD+EIR IMAQYMPLE+ Sbjct: 588 KYRIRSYMDAEIRGIMAQYMPLES 611
>VSR6_ARATH (Q9FYH7) Vacuolar sorting receptor 6 precursor (AtVSR6) (Epidermal| growth factor receptor-like protein 6) (AtELP6) (BP80-like protein d) (AtBP80d) Length = 622 Score = 43.5 bits (101), Expect = 1e-04 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = -2 Query: 323 KYRIRRYMDSEIRAIMAQYMPLEN 252 KYR+R YMDSEI AIM+QYMPLE+ Sbjct: 577 KYRLRSYMDSEIMAIMSQYMPLES 600
>VSR7_ARATH (Q8L7E3) Vacuolar sorting receptor 7 precursor (AtVSR7) (Epidermal| growth factor receptor-like protein 3) (AtELP3) (BP80-like protein f) (AtBP80f) Length = 625 Score = 41.2 bits (95), Expect = 7e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 323 KYRIRRYMDSEIRAIMAQYMPLEN 252 KYR R YMDSEI IM+QYMPLE+ Sbjct: 587 KYRFRSYMDSEIMTIMSQYMPLES 610
>VSR5_ARATH (O64758) Vacuolar sorting receptor 5 precursor (AtVSR5) (Epidermal| growth factor receptor-like protein 5) (AtELP5) (BP80-like protein e) (AtBP80e) Length = 618 Score = 35.4 bits (80), Expect = 0.036 Identities = 14/24 (58%), Positives = 21/24 (87%) Frame = -2 Query: 323 KYRIRRYMDSEIRAIMAQYMPLEN 252 KY ++ YMDSEI +IM+QY+PL++ Sbjct: 586 KYHLQSYMDSEIVSIMSQYIPLDS 609
>IMDH_STRPY (P0C0H6) Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) (IMP| dehydrogenase) (IMPDH) (IMPD) Length = 492 Score = 28.9 bits (63), Expect = 3.4 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -2 Query: 275 AQYMPLENXGDIHSHPHQIEMXKXTPHSPVY 183 AQ++ + G I SHPH +++ P+ V+ Sbjct: 462 AQFVEMSGAGLIESHPHDVQITNEAPNYSVH 492
>IMDH_STRP8 (P68839) Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) (IMP| dehydrogenase) (IMPDH) (IMPD) Length = 492 Score = 28.9 bits (63), Expect = 3.4 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -2 Query: 275 AQYMPLENXGDIHSHPHQIEMXKXTPHSPVY 183 AQ++ + G I SHPH +++ P+ V+ Sbjct: 462 AQFVEMSGAGLIESHPHDVQITNEAPNYSVH 492
>IMDH_STRP6 (Q5X9A3) Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) (IMP| dehydrogenase) (IMPDH) (IMPD) Length = 492 Score = 28.9 bits (63), Expect = 3.4 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -2 Query: 275 AQYMPLENXGDIHSHPHQIEMXKXTPHSPVY 183 AQ++ + G I SHPH +++ P+ V+ Sbjct: 462 AQFVEMSGAGLIESHPHDVQITNEAPNYSVH 492
>IMDH_STRP3 (Q8K5G1) Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) (IMP| dehydrogenase) (IMPDH) (IMPD) Length = 492 Score = 28.9 bits (63), Expect = 3.4 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -2 Query: 275 AQYMPLENXGDIHSHPHQIEMXKXTPHSPVY 183 AQ++ + G I SHPH +++ P+ V+ Sbjct: 462 AQFVEMSGAGLIESHPHDVQITNEAPNYSVH 492
>IMDH_STRP1 (P0C0H7) Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) (IMP| dehydrogenase) (IMPDH) (IMPD) Length = 492 Score = 28.9 bits (63), Expect = 3.4 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -2 Query: 275 AQYMPLENXGDIHSHPHQIEMXKXTPHSPVY 183 AQ++ + G I SHPH +++ P+ V+ Sbjct: 462 AQFVEMSGAGLIESHPHDVQITNEAPNYSVH 492
>PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Apoptosis-associated nuclear protein) (Proline- and histidine-rich protein) (Proline- and glutamine-rich protein) (PQ-rich protein) Length = 259 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -2 Query: 239 HSHPHQIEMXKXTPHSPVYGTNIFRS 162 H HPHQI PHS +G + RS Sbjct: 229 HPHPHQIPHPHPQPHSQPHGHRLLRS 254
>ZCH11_HUMAN (Q5TAX3) Zinc finger CCHC domain-containing protein 11| Length = 1644 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -2 Query: 275 AQYMPLENXGDIHSHPHQIEMXKXTPHSPV 186 AQY P+ N G + HP QI H PV Sbjct: 1482 AQYSPMHNMGLLPMHPLQIPAPSWPIHGPV 1511 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,684,398 Number of Sequences: 219361 Number of extensions: 800574 Number of successful extensions: 1998 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1998 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
