| Clone Name | rbags23h16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TM9S3_MOUSE (Q9ET30) Transmembrane 9 superfamily protein member ... | 44 | 2e-04 | 2 | TM9S3_HUMAN (Q9HD45) Transmembrane 9 superfamily protein member ... | 44 | 2e-04 | 3 | EMP70_YEAST (P32802) Endosomal P24A protein precursor (70 kDa en... | 33 | 0.42 | 4 | FBX5_HUMAN (Q9UKT4) F-box only protein 5 (Early mitotic inhibito... | 29 | 7.9 | 5 | ARFR_ARATH (Q9C5W9) Auxin response factor 18 | 29 | 7.9 |
|---|
>TM9S3_MOUSE (Q9ET30) Transmembrane 9 superfamily protein member 3 precursor| Length = 587 Score = 43.9 bits (102), Expect = 2e-04 Identities = 17/26 (65%), Positives = 23/26 (88%) Frame = -3 Query: 495 GILCGAIGYVGSTLFVRRIYRNIKCD 418 GI+CGAIGY+G++ FVR+IY N+K D Sbjct: 562 GIMCGAIGYMGTSAFVRKIYTNVKID 587
>TM9S3_HUMAN (Q9HD45) Transmembrane 9 superfamily protein member 3 precursor| (SM-11044-binding protein) (EP70-P-iso) Length = 589 Score = 43.9 bits (102), Expect = 2e-04 Identities = 17/26 (65%), Positives = 23/26 (88%) Frame = -3 Query: 495 GILCGAIGYVGSTLFVRRIYRNIKCD 418 GI+CGAIGY+G++ FVR+IY N+K D Sbjct: 564 GIMCGAIGYMGTSAFVRKIYTNVKID 589
>EMP70_YEAST (P32802) Endosomal P24A protein precursor (70 kDa endomembrane| protein) (Pheromone alpha-factor transporter) (Acidic 24 kDa late endocytic intermediate component) Length = 667 Score = 33.1 bits (74), Expect = 0.42 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = -3 Query: 492 ILCGAIGYVGSTLFVRRIYRNIKCD 418 ++ G+IG++ S LFVR+IY +IK D Sbjct: 643 LVTGSIGFISSMLFVRKIYSSIKVD 667
>FBX5_HUMAN (Q9UKT4) F-box only protein 5 (Early mitotic inhibitor 1)| Length = 447 Score = 28.9 bits (63), Expect = 7.9 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 145 KETKKNKNLHQALVLNS*ATTDVYTMRAAPGNK*VCKKKGC 267 K KKN++L + NS A D Y RA CK++GC Sbjct: 367 KTLKKNESLKACIRCNSPAKYDCYLQRA------TCKREGC 401
>ARFR_ARATH (Q9C5W9) Auxin response factor 18| Length = 602 Score = 28.9 bits (63), Expect = 7.9 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 343 FQSNGTYMISSDTAPPPPHICSRKLITFDVSVDSP 447 + SN ++ PPPP CS +L FD++ +SP Sbjct: 421 YSSNNSF---KPETPPPPTNCSYRLFGFDLTSNSP 452 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,599,249 Number of Sequences: 219361 Number of extensions: 1273298 Number of successful extensions: 3334 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3333 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)