| Clone Name | rbags23d23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HEM1_CLOTE (Q897K9) Glutamyl-tRNA reductase (EC 1.2.1.70) (GluTR) | 32 | 1.7 | 2 | IPNS_STRCL (P10621) Isopenicillin N synthetase (EC 1.21.3.1) (IP... | 31 | 2.8 | 3 | GLYG3_SOYBN (P11828) Glycinin G3 precursor [Contains: Glycinin A... | 31 | 3.7 | 4 | AMO1_ASPNG (Q12556) Copper amine oxidase 1 (EC 1.4.3.6) | 30 | 4.9 |
|---|
>HEM1_CLOTE (Q897K9) Glutamyl-tRNA reductase (EC 1.2.1.70) (GluTR)| Length = 399 Score = 32.0 bits (71), Expect = 1.7 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 548 ILSRVFNCVRNEYYYYKAIIHYTSDENINH 637 I+S +F C+ + Y K HY DE INH Sbjct: 62 IISHIFKCLNWDENYKKYTFHYKDDEAINH 91
>IPNS_STRCL (P10621) Isopenicillin N synthetase (EC 1.21.3.1) (IPNS)| (Isopenicillin N synthase) Length = 329 Score = 31.2 bits (69), Expect = 2.8 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +1 Query: 145 DQSADDLMVHVHTSDG*SSDGYYYKSTDGRPQFLEACWMASNPPYGQ 285 DQ DL +H + D YYK+ GR C++ NP +G+ Sbjct: 68 DQEKHDLAIHAYNPDNPHVRNGYYKAVPGRKAVESFCYL--NPDFGE 112
>GLYG3_SOYBN (P11828) Glycinin G3 precursor [Contains: Glycinin A subunit;| Glycinin B subunit] Length = 481 Score = 30.8 bits (68), Expect = 3.7 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -2 Query: 283 GHMEGWRPSNMPQETAAVHRWIYSNIRHSISRPMYARAPSD 161 G +E W P+N P + A V + R+++ RP Y AP + Sbjct: 50 GFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNAPQE 90
>AMO1_ASPNG (Q12556) Copper amine oxidase 1 (EC 1.4.3.6)| Length = 671 Score = 30.4 bits (67), Expect = 4.9 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -1 Query: 320 LPNGHFQISVDSWPYGGLEAIQHASR 243 LP G F++ ++ WPYGGL+ ++ R Sbjct: 136 LPEG-FEVVIEPWPYGGLDYVEEKRR 160 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,340,694 Number of Sequences: 219361 Number of extensions: 2007682 Number of successful extensions: 4386 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4386 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6257125380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)