| Clone Name | rbags23b12 |
|---|---|
| Clone Library Name | barley_pub |
>KSG3_ARATH (P43289) Shaggy-related protein kinase gamma (EC 2.7.11.1)| (ASK-gamma) Length = 409 Score = 129 bits (324), Expect = 8e-30 Identities = 57/69 (82%), Positives = 65/69 (94%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLLQYSPNLRC A+++LVHPFFDELRDP RLPNGRFLPPLFNFKP+ELKG+PV++ AK Sbjct: 335 SRLLQYSPNLRCAALDSLVHPFFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAK 394 Query: 481 LIPEHARKQ 455 L+PEHARKQ Sbjct: 395 LVPEHARKQ 403
>KSG1_ARATH (P43288) Shaggy-related protein kinase alpha (EC 2.7.11.1)| (ASK-alpha) Length = 405 Score = 124 bits (310), Expect = 3e-28 Identities = 55/69 (79%), Positives = 63/69 (91%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLLQYSPNLR A++ LVHPFFDELRDP RLPNGRFLPPLFNFKP+ELKG+P+++ AK Sbjct: 331 SRLLQYSPNLRSAALDTLVHPFFDELRDPNARLPNGRFLPPLFNFKPHELKGVPLEMVAK 390 Query: 481 LIPEHARKQ 455 L+PEHARKQ Sbjct: 391 LVPEHARKQ 399
>MSK2_MEDSA (P51138) Glycogen synthase kinase-3 homolog MsK-2 (EC 2.7.11.1)| Length = 411 Score = 123 bits (309), Expect = 4e-28 Identities = 57/71 (80%), Positives = 62/71 (87%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLLQYSPNLR TA+EALVHPFFDELRDP TRLPNGR LPPLFNFK NELKG+P ++ K Sbjct: 336 SRLLQYSPNLRSTALEALVHPFFDELRDPNTRLPNGRHLPPLFNFKANELKGVPAEMLVK 395 Query: 481 LIPEHARKQSS 449 L+P HARKQ S Sbjct: 396 LVPSHARKQCS 406
>MSK1_MEDSA (P51137) Glycogen synthase kinase-3 homolog MsK-1 (EC 2.7.11.1)| Length = 411 Score = 122 bits (305), Expect = 1e-27 Identities = 54/69 (78%), Positives = 60/69 (86%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLLQYSPNLRC A++ L HPFFDELRDP RLP GRFLPPLFNFKP+ELKG+PV+ K Sbjct: 337 SRLLQYSPNLRCQALDCLTHPFFDELRDPNARLPTGRFLPPLFNFKPHELKGVPVETLMK 396 Query: 481 LIPEHARKQ 455 L+PEHARKQ Sbjct: 397 LVPEHARKQ 405
>MSK3_MEDSA (P51139) Glycogen synthase kinase-3 homolog MsK-3 (EC 2.7.11.1)| Length = 411 Score = 120 bits (302), Expect = 3e-27 Identities = 54/69 (78%), Positives = 62/69 (89%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLLQYSPNLR TA+EALVHPF+D++RDP TRLPNGRFLPPLFNFK NELKG+P ++ K Sbjct: 336 SRLLQYSPNLRSTALEALVHPFYDDVRDPNTRLPNGRFLPPLFNFKVNELKGVPAEMLVK 395 Query: 481 LIPEHARKQ 455 L+P HARKQ Sbjct: 396 LVPPHARKQ 404
>KSG5_ARATH (Q8VZD5) Shaggy-related protein kinase epsilon (EC 2.7.11.1)| (ASK-epsilon) Length = 410 Score = 120 bits (301), Expect = 4e-27 Identities = 56/71 (78%), Positives = 63/71 (88%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLLQYSPNLR TA+EA+VHPFFDELRDP TRLPNGR LPPLFNFKP ELKG +++ +K Sbjct: 336 SRLLQYSPNLRSTAMEAIVHPFFDELRDPNTRLPNGRALPPLFNFKPQELKGASLELLSK 395 Query: 481 LIPEHARKQSS 449 LIP+HARKQ S Sbjct: 396 LIPDHARKQCS 406
>KSG4_ARATH (Q9FVS6) Shaggy-related protein kinase delta (EC 2.7.11.1)| (ASK-delta) Length = 420 Score = 116 bits (290), Expect = 7e-26 Identities = 52/69 (75%), Positives = 57/69 (82%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAKL 479 R QYSPNLRCTAVEA +HPFFDELRDP RLPNGR LPPLFNFKP EL GIP + +L Sbjct: 345 RFFQYSPNLRCTAVEACIHPFFDELRDPNARLPNGRPLPPLFNFKPQELSGIPPETVDRL 404 Query: 478 IPEHARKQS 452 +PEHARKQ+ Sbjct: 405 VPEHARKQN 413
>KSG10_ARATH (Q39019) Shaggy-related protein kinase kappa (EC 2.7.11.1)| (ASK-kappa) (AtK-1) Length = 421 Score = 115 bits (289), Expect = 9e-26 Identities = 51/69 (73%), Positives = 58/69 (84%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAKL 479 R QYSPNLRCTA+EA +HP FDELRDP TRLPNGR LPPLFNFKP EL GIP ++ +L Sbjct: 346 RFFQYSPNLRCTALEACIHPLFDELRDPNTRLPNGRPLPPLFNFKPQELSGIPPEIVNRL 405 Query: 478 IPEHARKQS 452 +PEHARKQ+ Sbjct: 406 VPEHARKQN 414
>MSK1_TOBAC (Q40518) Shaggy-related protein kinase NtK-1 (EC 2.7.11.1)| Length = 409 Score = 115 bits (288), Expect = 1e-25 Identities = 53/69 (76%), Positives = 59/69 (85%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLLQYSPNLRCTA+EA+ H FFDELRDP TRLPNGR LPPLFNFK +ELKG+ + K Sbjct: 335 SRLLQYSPNLRCTALEAVTHAFFDELRDPNTRLPNGRVLPPLFNFKAHELKGVSAENLLK 394 Query: 481 LIPEHARKQ 455 L+PEHARKQ Sbjct: 395 LVPEHARKQ 403
>KSG2_ARATH (O23145) Shaggy-related protein kinase beta (EC 2.7.11.1)| (ASK-beta) Length = 431 Score = 102 bits (255), Expect = 8e-22 Identities = 48/68 (70%), Positives = 54/68 (79%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLLQYSPNLRCTA+EA HPFFD+LRDP LPNGR LPPLF+F EL G V++ + Sbjct: 364 SRLLQYSPNLRCTALEACAHPFFDDLRDPRASLPNGRALPPLFDFTAQELAGASVELRHR 423 Query: 481 LIPEHARK 458 LIPEHARK Sbjct: 424 LIPEHARK 431
>KSG9_ARATH (Q39012) Shaggy-related protein kinase iota (EC 2.7.11.1)| (ASK-iota) Length = 407 Score = 99.8 bits (247), Expect = 7e-21 Identities = 48/71 (67%), Positives = 57/71 (80%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLLQYSP+LRCTA+EA HPFF+ELR+P RLPNGR LPPLFNFK EL G +++ + Sbjct: 332 SRLLQYSPSLRCTALEACAHPFFNELREPNARLPNGRPLPPLFNFK-QELGGASMELINR 390 Query: 481 LIPEHARKQSS 449 LIPEH R+Q S Sbjct: 391 LIPEHVRRQMS 401
>KSG6_ARATH (Q39010) Shaggy-related protein kinase dzeta (EC 2.7.11.1)| (ASK-dzeta) Length = 412 Score = 98.2 bits (243), Expect = 2e-20 Identities = 47/69 (68%), Positives = 55/69 (79%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLLQYSP+LRCTA+EA HPFF+ELR+P RLPNGR LPPLFNFK EL G ++ + Sbjct: 334 SRLLQYSPSLRCTALEACAHPFFNELREPNARLPNGRPLPPLFNFK-QELSGASPELINR 392 Query: 481 LIPEHARKQ 455 LIPEH R+Q Sbjct: 393 LIPEHVRRQ 401
>KSG8_ARATH (Q96287) Shaggy-related protein kinase theta (EC 2.7.11.1)| (ASK-theta) Length = 472 Score = 97.4 bits (241), Expect = 3e-20 Identities = 45/71 (63%), Positives = 51/71 (71%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLLQYSPNLRCTA+EA HPFFD+LRDP LPNGR LPPLFNF EL G ++ + Sbjct: 400 SRLLQYSPNLRCTALEACAHPFFDDLRDPNVSLPNGRALPPLFNFTAQELAGASTELRQR 459 Query: 481 LIPEHARKQSS 449 LIP H + S Sbjct: 460 LIPAHCQGTGS 470
>KSG7_ARATH (Q39011) Shaggy-related protein kinase eta (EC 2.7.11.1) (ASK-eta)| (BRASSINOSTEROID-INSENSITIVE 2) (ULTRACURVATA1) Length = 380 Score = 95.5 bits (236), Expect = 1e-19 Identities = 45/69 (65%), Positives = 54/69 (78%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLLQYSP+LRCTA+EA HPFFDELR+P RLPNGR PPLFNFK E+ G ++ K Sbjct: 302 SRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPLFNFK-QEVAGSSPELVNK 360 Query: 481 LIPEHARKQ 455 LIP+H ++Q Sbjct: 361 LIPDHIKRQ 369
>KSGT_BRANA (O04160) Shaggy-related protein kinase theta (EC 2.7.11.1)| (ASK-theta) Length = 468 Score = 94.0 bits (232), Expect = 4e-19 Identities = 43/67 (64%), Positives = 49/67 (73%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLLQYSPNLRCTA+EA HPFFD+LR P LPNGR LPPLFNF EL G ++ + Sbjct: 396 SRLLQYSPNLRCTALEACAHPFFDDLRAPNVSLPNGRALPPLFNFTAQELAGASTELRQR 455 Query: 481 LIPEHAR 461 LIP H + Sbjct: 456 LIPAHCQ 462
>GSK3B_RAT (P18266) Glycogen synthase kinase-3 beta (EC 2.7.11.26) (GSK-3| beta) (Factor A) (FA) Length = 420 Score = 78.2 bits (191), Expect = 2e-14 Identities = 40/71 (56%), Positives = 47/71 (66%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLL+Y+P R T +EA H FFDELRDP +LPNGR P LFNF EL P +A Sbjct: 318 SRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNP-PLATI 376 Query: 481 LIPEHARKQSS 449 LIP HAR Q++ Sbjct: 377 LIPPHARIQAA 387
>GSK3B_MOUSE (Q9WV60) Glycogen synthase kinase-3 beta (EC 2.7.11.26) (GSK-3| beta) Length = 420 Score = 78.2 bits (191), Expect = 2e-14 Identities = 40/71 (56%), Positives = 47/71 (66%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLL+Y+P R T +EA H FFDELRDP +LPNGR P LFNF EL P +A Sbjct: 318 SRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNP-PLATI 376 Query: 481 LIPEHARKQSS 449 LIP HAR Q++ Sbjct: 377 LIPPHARIQAA 387
>GSK3B_HUMAN (P49841) Glycogen synthase kinase-3 beta (EC 2.7.11.26) (GSK-3| beta) Length = 420 Score = 78.2 bits (191), Expect = 2e-14 Identities = 40/71 (56%), Positives = 47/71 (66%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 SRLL+Y+P R T +EA H FFDELRDP +LPNGR P LFNF EL P +A Sbjct: 318 SRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNP-PLATI 376 Query: 481 LIPEHARKQSS 449 LIP HAR Q++ Sbjct: 377 LIPPHARIQAA 387
>GSK3_SCHPO (Q10452) Protein kinase gsk3 (EC 2.7.11.1) (Protein kinaae skp1)| Length = 387 Score = 76.3 bits (186), Expect = 8e-14 Identities = 42/74 (56%), Positives = 48/74 (64%), Gaps = 7/74 (9%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNG-------RFLPPLFNFKPNELKGI 503 S++LQY+P R TA EA+ HPFFDELRDP T+L N R LP LFNF P EL I Sbjct: 294 SKMLQYTPTDRLTAAEAMCHPFFDELRDPNTKLHNSRNPDASPRHLPELFNFSPFEL-SI 352 Query: 502 PVDVAAKLIPEHAR 461 D+ KLIP HAR Sbjct: 353 RPDLNQKLIPSHAR 366
>GSK3A_RAT (P18265) Glycogen synthase kinase-3 alpha (EC 2.7.11.26) (GSK-3| alpha) (Factor A) (FA) Length = 483 Score = 74.7 bits (182), Expect = 2e-13 Identities = 40/73 (54%), Positives = 47/73 (64%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 S LL+Y+P+ R + +EA H FFDELR GT+LPN R LPPLFNF P EL I + A Sbjct: 381 SSLLEYTPSSRLSPLEACAHSFFDELRSLGTQLPNNRPLPPLFNFSPGEL-SIQPSLNAI 439 Query: 481 LIPEHARKQSSHA 443 LIP H R S A Sbjct: 440 LIPPHLRSPSGPA 452
>GSK3H_DICDI (P51136) Glycogen synthase kinase-3 homolog (EC 2.7.11.26) (GSK-3)| Length = 467 Score = 72.8 bits (177), Expect = 9e-13 Identities = 37/69 (53%), Positives = 43/69 (62%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 S++L Y P+ R VE HPFFDELRDP T LP+G+ LPPLFNF E I +A Sbjct: 317 SKILLYDPSSRLKPVEICAHPFFDELRDPKTCLPDGKPLPPLFNFTIAEQTSIGPKLAKT 376 Query: 481 LIPEHARKQ 455 LIP HA Q Sbjct: 377 LIPSHAMNQ 385
>GSK3A_HUMAN (P49840) Glycogen synthase kinase-3 alpha (EC 2.7.11.26) (GSK-3| alpha) Length = 483 Score = 68.6 bits (166), Expect = 2e-11 Identities = 37/67 (55%), Positives = 44/67 (65%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPVDVAAK 482 S LL+Y+P+ R + +EA H FFDELR GT+LPN R LPPLFNF EL I + A Sbjct: 381 SSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLPPLFNFSAGEL-SIQPSLNAI 439 Query: 481 LIPEHAR 461 LIP H R Sbjct: 440 LIPPHLR 446
>SGG_DROME (P18431) Protein kinase shaggy (EC 2.7.11.1) (Protein zeste-white 3)| Length = 1067 Score = 67.4 bits (163), Expect = 4e-11 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 1/71 (1%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTR-LPNGRFLPPLFNFKPNELKGIPVDVAA 485 S LL+Y+P+ R T ++A HPFFDELR G LPNGR +PPLFNF +EL I + Sbjct: 869 SLLLEYTPSARITPLKACAHPFFDELRMEGNHTLPNGRDMPPLFNFTEHEL-SIQPSLVP 927 Query: 484 KLIPEHARKQS 452 +L+P+H + S Sbjct: 928 QLLPKHLQNAS 938
>GSK3H_DROME (P83101) Putative glycogen synthase kinase-3 homolog (EC 2.7.11.26)| (GSK-3) (Protein gasket) Length = 501 Score = 63.9 bits (154), Expect = 4e-10 Identities = 35/64 (54%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELR-DPGTRLPNGRFLPPLFNFKPNELKGIPVDVAA 485 S++L YSPN R + + HPFFDELR DP +LPNGR LPPLFNF E K I D Sbjct: 295 SKMLIYSPNARVSPLMGCAHPFFDELRQDPHQQLPNGRSLPPLFNFTDYE-KTIEPDTMP 353 Query: 484 KLIP 473 L+P Sbjct: 354 LLLP 357
>GSK31_SCHPO (Q9URT9) Protein kinase gsk31 (EC 2.7.11.1)| Length = 381 Score = 52.8 bits (125), Expect = 9e-07 Identities = 30/71 (42%), Positives = 39/71 (54%), Gaps = 7/71 (9%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNG-------RFLPPLFNFKPNELKGIP 500 ++L Y P+ R +A+E L HPFFDELRDP R LPPLFNF EL I Sbjct: 288 KMLTYVPSKRISAIEVLTHPFFDELRDPNCMYHCSRDEGTIERHLPPLFNFNLAEL-SIR 346 Query: 499 VDVAAKLIPEH 467 ++ ++P H Sbjct: 347 PNLNKAILPPH 357
>CDPK2_PLAF7 (Q8ICR0) Calcium-dependent protein kinase 2 (EC 2.7.11.1) (PfCDPK2)| Length = 508 Score = 40.4 bits (93), Expect = 0.005 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLP-NGRFLPPLFNF-KPNELKGIPVDVA 488 ++LL Y+PN RCT EAL HP+ ++ + + L L NF K NELK I + + Sbjct: 303 TKLLTYNPNERCTIEEALNHPWITQMTKSHEHVELSSTLLKNLKNFKKENELKKIALTII 362 Query: 487 AK 482 AK Sbjct: 363 AK 364
>CDPK2_PLAFK (O15865) Calcium-dependent protein kinase 2 (EC 2.7.11.1) (PfCDPK2)| Length = 512 Score = 40.4 bits (93), Expect = 0.005 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRLP-NGRFLPPLFNF-KPNELKGIPVDVA 488 ++LL Y+PN RCT EAL HP+ ++ + + L L NF K NELK I + + Sbjct: 303 TKLLTYNPNERCTIEEALNHPWITQMTKSHEHVELSSTLLKNLKNFKKENELKKIALTII 362 Query: 487 AK 482 AK Sbjct: 363 AK 364
>KOM8_YEAST (Q12222) Probable serine/threonine-protein kinase YOL128C (EC| 2.7.11.1) Length = 375 Score = 39.7 bits (91), Expect = 0.008 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGR----FLPPLFNFKPNELKGI 503 ++L Y RC A + + H FFD LR+ LP G LP LFNF +E + + Sbjct: 308 KVLTYDATERCDARQLMAHEFFDALRNETYFLPRGSSMPVHLPDLFNFSASEKRAL 363
>MCK1_YEAST (P21965) Protein kinase MCK1 (EC 2.7.11.1) (Meiosis and centromere| regulatory kinase) Length = 375 Score = 37.7 bits (86), Expect = 0.031 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 4/54 (7%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRF----LPPLFNFKPNELK 509 ++L Y P R + L H FF+ELR+ T LP G LP LF+F EL+ Sbjct: 306 KILVYEPQQRLSPRRILAHQFFNELRNDDTFLPRGFTEPIKLPNLFDFNDFELQ 359
>CDC2H_DICDI (P34117) CDC2-like serine/threonine-protein kinase CRP (EC| 2.7.11.22) (EC 2.7.11.23) Length = 292 Score = 37.4 bits (85), Expect = 0.040 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDEL 584 S++LQY PN R TA AL HP+FD L Sbjct: 263 SKMLQYDPNQRITAAAALKHPYFDGL 288
>CSK2A_NEUCR (Q8TG13) Casein kinase II subunit alpha (EC 2.7.11.1) (CK II alpha| subunit) Length = 336 Score = 36.6 bits (83), Expect = 0.069 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDPGTR 566 +LL+Y N R TA EA+ HP+F +RD TR Sbjct: 296 KLLRYDHNERLTAKEAMAHPYFAPVRDEATR 326
>FUS3_YEAST (P16892) Mitogen-activated protein kinase FUS3 (EC 2.7.11.24) (MAP| kinase FUS3) Length = 353 Score = 36.2 bits (82), Expect = 0.090 Identities = 18/42 (42%), Positives = 22/42 (52%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLF 533 R+L + P R TA EAL HP+ DP P G +PP F Sbjct: 288 RMLVFDPAKRITAKEALEHPYLQTYHDPNDE-PEGEPIPPSF 328
>PHKG2_RAT (P31325) Phosphorylase b kinase gamma catalytic chain, testis/liver| isoform (EC 2.7.11.19) (PHK-gamma-T) (Phosphorylase kinase gamma subunit 2) Length = 406 Score = 35.8 bits (81), Expect = 0.12 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELR--DPGTRLPNGRF 548 ++LLQ PN R TA +AL HPFF+ + P P RF Sbjct: 269 AKLLQVDPNARLTAEQALQHPFFERCKGSQPWNLTPRQRF 308
>CDC2_CAEEL (P34556) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) (p34 protein kinase) Length = 332 Score = 35.4 bits (80), Expect = 0.15 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = -2 Query: 655 LLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRF 548 LL Y P+LR A +ALVHP+FD + ++LP G + Sbjct: 292 LLIYDPSLRLNAKKALVHPYFDNM--DTSKLPAGNY 325
>PHKG2_HUMAN (P15735) Phosphorylase b kinase gamma catalytic chain, testis/liver| isoform (EC 2.7.11.19) (PHK-gamma-T) (Phosphorylase kinase gamma subunit 2) (PSK-C3) Length = 406 Score = 35.4 bits (80), Expect = 0.15 Identities = 20/40 (50%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFD--ELRDPGTRLPNGRF 548 SRLLQ P R TA +AL HPFF+ E P P RF Sbjct: 269 SRLLQVDPEARLTAEQALQHPFFERCEGSQPWNLTPRQRF 308
>ERK1_DICDI (P42525) Extracellular signal-regulated kinase 1 (EC 2.7.11.24)| (ERK1) (MAP kinase 1) Length = 415 Score = 35.4 bits (80), Expect = 0.15 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 R+L + P+ R T EAL HP+F L DP Sbjct: 300 RMLYFDPSKRLTVEEALAHPYFQSLHDP 327
>CDK2_RAT (Q63699) Cell division protein kinase 2 (EC 2.7.11.22)| Length = 298 Score = 34.7 bits (78), Expect = 0.26 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDP 575 S++L Y PN R +A AL HPFF ++ P Sbjct: 264 SQMLHYDPNKRISAKAALAHPFFQDVTKP 292
>CDK2_MESAU (P48963) Cell division protein kinase 2 (EC 2.7.11.22)| Length = 298 Score = 34.7 bits (78), Expect = 0.26 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDP 575 S++L Y PN R +A AL HPFF ++ P Sbjct: 264 SQMLHYDPNKRISAKAALAHPFFQDVTKP 292
>CDK2_HUMAN (P24941) Cell division protein kinase 2 (EC 2.7.11.22) (p33 protein| kinase) Length = 298 Score = 34.7 bits (78), Expect = 0.26 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDP 575 S++L Y PN R +A AL HPFF ++ P Sbjct: 264 SQMLHYDPNKRISAKAALAHPFFQDVTKP 292
>CDK2_CRIGR (O55076) Cell division protein kinase 2 (EC 2.7.11.22)| Length = 298 Score = 34.7 bits (78), Expect = 0.26 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDP 575 S++L Y PN R +A AL HPFF ++ P Sbjct: 264 SQMLHYDPNKRISAKAALAHPFFQDVTKP 292
>CDK2_BOVIN (Q5E9Y0) Cell division protein kinase 2 (EC 2.7.11.22)| Length = 298 Score = 34.7 bits (78), Expect = 0.26 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDP 575 S++L Y PN R +A AL HPFF ++ P Sbjct: 264 SQMLHYDPNKRISAKAALAHPFFQDVTKP 292
>CDK2_MOUSE (P97377) Cell division protein kinase 2 (EC 2.7.11.22)| Length = 346 Score = 34.7 bits (78), Expect = 0.26 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDP 575 S++L Y PN R +A AL HPFF ++ P Sbjct: 312 SQMLHYDPNKRISAKAALAHPFFQDVTKP 340
>CC2H2_TRYBB (P54665) Cell division control protein 2 homolog 2 (EC 2.7.11.22)| Length = 345 Score = 34.7 bits (78), Expect = 0.26 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRD 578 R+L Y+P R TA EAL H +FDE+R+ Sbjct: 307 RMLCYNPRERITAYEALQHSYFDEVRE 333
>CDC2_DICDI (P34112) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) (p34 protein kinase) Length = 296 Score = 34.3 bits (77), Expect = 0.34 Identities = 13/26 (50%), Positives = 21/26 (80%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDEL 584 +++LQY P+ R +A EAL+HP+F +L Sbjct: 266 AKMLQYEPSKRISAKEALLHPYFGDL 291
>PHKG2_MOUSE (Q9DB30) Phosphorylase b kinase gamma catalytic chain, testis/liver| isoform (EC 2.7.11.19) (PHK-gamma-T) (Phosphorylase kinase gamma subunit 2) Length = 406 Score = 34.3 bits (77), Expect = 0.34 Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFD--ELRDPGTRLPNGRF 548 S+LLQ P R TA +AL HPFF+ E P P RF Sbjct: 269 SKLLQVDPEARLTAEQALQHPFFERCEGSQPWNLTPRQRF 308
>MK03_RAT (P21708) Mitogen-activated protein kinase 3 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 1) (ERK-1) (Insulin-stimulated MAP2 kinase) (MAP kinase 1) (MAPK 1) (p44-ERK1) (ERT2) (p44-MAPK) (Microtubule-associated protein 2 kinase) (MNK1) Length = 380 Score = 34.3 bits (77), Expect = 0.34 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 R+L ++PN R T EAL HP+ ++ DP Sbjct: 310 RMLTFNPNKRITVEEALAHPYLEQYYDP 337
>MK03_MOUSE (Q63844) Mitogen-activated protein kinase 3 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 1) (ERK-1) (Insulin-stimulated MAP2 kinase) (MAP kinase 1) (MAPK 1) (p44-ERK1) (ERT2) (p44-MAPK) (Microtubule-associated protein 2 kinase) (MNK1) Length = 380 Score = 34.3 bits (77), Expect = 0.34 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 R+L ++PN R T EAL HP+ ++ DP Sbjct: 310 RMLTFNPNKRITVEEALAHPYLEQYYDP 337
>CLK4_HUMAN (Q9HAZ1) Dual specificity protein kinase CLK4 (EC 2.7.12.1)| (CDC-like kinase 4) Length = 481 Score = 34.3 bits (77), Expect = 0.34 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELR 581 R+L+Y P R T EAL HPFFD L+ Sbjct: 454 RMLEYDPTQRITLDEALQHPFFDLLK 479
>MK03_HUMAN (P27361) Mitogen-activated protein kinase 3 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 1) (ERK-1) (Insulin-stimulated MAP2 kinase) (MAP kinase 1) (MAPK 1) (p44-ERK1) (ERT2) (p44-MAPK) (Microtubule-associated protein 2 kinase) Length = 379 Score = 34.3 bits (77), Expect = 0.34 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 R+L ++PN R T EAL HP+ ++ DP Sbjct: 309 RMLTFNPNKRITVEEALAHPYLEQYYDP 336
>CDC2D_ANTMA (Q38775) Cell division control protein 2 homolog D (EC 2.7.11.22)| (EC 2.7.11.23) Length = 312 Score = 33.9 bits (76), Expect = 0.45 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPG 572 S +L Y P+ R +A +A+ HP+FDEL G Sbjct: 282 SEMLHYEPSRRISAKKAMEHPYFDELDKSG 311
>PHKG1_RAT (P13286) Phosphorylase b kinase gamma catalytic chain, skeletal| muscle isoform (EC 2.7.11.19) (Phosphorylase kinase gamma subunit 1) Length = 387 Score = 33.9 bits (76), Expect = 0.45 Identities = 19/40 (47%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTR--LPNGRF 548 SR L P RC+A EAL HPFF E R P G+F Sbjct: 265 SRFLVVQPQDRCSAEEALAHPFFQEYVVEEVRHFSPRGKF 304
>PHKG1_MOUSE (P07934) Phosphorylase b kinase gamma catalytic chain, skeletal| muscle isoform (EC 2.7.11.19) (Phosphorylase kinase gamma subunit 1) Length = 387 Score = 33.9 bits (76), Expect = 0.45 Identities = 19/40 (47%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTR--LPNGRF 548 SR L P RC+A EAL HPFF E R P G+F Sbjct: 265 SRFLVVQPQDRCSAEEALAHPFFQEYVVEEVRHFSPRGKF 304
>NTF3_TOBAC (Q40517) Mitogen-activated protein kinase homolog NTF3 (EC| 2.7.11.24) (P43) Length = 372 Score = 33.9 bits (76), Expect = 0.45 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDPGTRLP 560 R+L + P+ R + +EAL HP+ L DP T P Sbjct: 298 RMLVFDPSKRISVIEALQHPYMSPLYDPNTDPP 330
>MK13_MOUSE (Q9Z1B7) Mitogen-activated protein kinase 13 (EC 2.7.11.24)| (Stress-activated protein kinase 4) (Mitogen-activated protein kinase p38 delta) (MAP kinase p38 delta) Length = 366 Score = 33.5 bits (75), Expect = 0.58 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 ++L+ + R TA +AL HPFF+ RDP Sbjct: 287 KMLELDVDKRLTAAQALAHPFFEPFRDP 314
>MK13_PANTR (Q9N272) Mitogen-activated protein kinase 13 (EC 2.7.11.24)| (Stress-activated protein kinase 4) Length = 365 Score = 33.5 bits (75), Expect = 0.58 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 ++L+ + R TA +AL HPFF+ RDP Sbjct: 287 KMLELDVDKRLTAAQALTHPFFEPFRDP 314
>MK13_HUMAN (O15264) Mitogen-activated protein kinase 13 (EC 2.7.11.24)| (Stress-activated protein kinase 4) (Mitogen-activated protein kinase p38 delta) (MAP kinase p38 delta) Length = 365 Score = 33.5 bits (75), Expect = 0.58 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 ++L+ + R TA +AL HPFF+ RDP Sbjct: 287 KMLELDVDKRLTAAQALTHPFFEPFRDP 314
>CLK4_MOUSE (O35493) Dual specificity protein kinase CLK4 (EC 2.7.12.1)| (CDC-like kinase 4) Length = 481 Score = 33.5 bits (75), Expect = 0.58 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELR 581 R+L+Y P R T EAL HPFFD L+ Sbjct: 454 RMLEYDPARRITLDEALQHPFFDLLK 479
>DOA_DROME (P49762) Serine/threonine-protein kinase Doa (EC 2.7.12.1) (Protein| darkener of apricot) Length = 832 Score = 33.5 bits (75), Expect = 0.58 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDEL 584 ++L+Y P+ R T EAL HPFFD L Sbjct: 778 KMLEYEPSSRITLGEALHHPFFDRL 802
>PHO85_DEBHA (Q6BRY2) Negative regulator of the PHO system (EC 2.7.11.22)| (Serine/threonine-protein kinase PHO85) Length = 330 Score = 33.1 bits (74), Expect = 0.76 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDP 575 S LLQ P+ R TA +AL HP+F E+ +P Sbjct: 268 SSLLQMRPDARITARQALQHPWFHEISNP 296
>MAPK_PETHY (Q40884) Mitogen-activated protein kinase homolog 1 (EC 2.7.11.24)| (PMEK1) Length = 384 Score = 33.1 bits (74), Expect = 0.76 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDPGTRLP 560 R+L + P+ R + +EAL HP+ L DP T P Sbjct: 298 RMLVFDPSKRISVMEALQHPYMSPLYDPNTDPP 330
>CDK2_ENTHI (Q04770) Cell division protein kinase 2 homolog (EC 2.7.11.22)| Length = 291 Score = 32.7 bits (73), Expect = 1.00 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 ++ Y+P R +A +AL HPFFD L P Sbjct: 262 KMFIYTPEKRISAADALKHPFFDPLNKP 289
>MK13_RAT (Q9WTY9) Mitogen-activated protein kinase 13 (EC 2.7.11.24)| (Stress-activated protein kinase 4) (Mitogen-activated protein kinase p38 delta) (MAP kinase p38 delta) Length = 366 Score = 32.7 bits (73), Expect = 1.00 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 ++L+ + R TA +AL HP F+ LRDP Sbjct: 287 KMLELDVDKRLTAAQALAHPLFEPLRDP 314
>CSK22_XENLA (P28020) Casein kinase II subunit alpha' (EC 2.7.11.1) (CK II)| Length = 392 Score = 32.7 bits (73), Expect = 1.00 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFF-----DELRDPGTRLPNGRFLP 542 +LL+Y R TA EA+ HP+F D+ R G+ +P+G P Sbjct: 303 KLLRYDHQTRLTAREAMDHPYFYPIVKDQSRMGGSNMPSGSSTP 346
>CAC1D_CHICK (O73700) Voltage-dependent L-type calcium channel alpha-1D subunit| (Voltage-gated calcium channel alpha subunit Cav1.3) (CHCACHA1D) Length = 2190 Score = 32.3 bits (72), Expect = 1.3 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +2 Query: 320 SRLPTAIGSSSGSHAAQPTSPGEMLTCRCNSNESDTGIS*SCMGALLSRVLRDQFCRN-I 496 SRL + G SS HA+ PTS E + N S G + +C G+L + + +F R Sbjct: 472 SRL-SCFGRSSNKHASMPTSETESVN---TENVSGEGENPACCGSLCQTISKSKFSRRWR 527 Query: 497 HWDSF 511 W+ F Sbjct: 528 RWNRF 532
>MPK7_ARATH (Q39027) Mitogen-activated protein kinase homolog 7 (EC 2.7.11.24)| (MAP kinase 7) (AtMPK7) Length = 368 Score = 32.3 bits (72), Expect = 1.3 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDPGTRLP 560 R+L + P R + +AL+HP+ L DPG+ P Sbjct: 298 RMLVFDPTKRISVTDALLHPYMAGLFDPGSNPP 330
>CLK1_HUMAN (P49759) Dual specificity protein kinase CLK1 (EC 2.7.12.1)| (CDC-like kinase 1) Length = 484 Score = 32.3 bits (72), Expect = 1.3 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELR 581 ++L+Y P R T EAL HPFFD L+ Sbjct: 456 KMLEYDPAKRITLREALKHPFFDLLK 481
>MK12_MOUSE (O08911) Mitogen-activated protein kinase 12 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 6) (ERK-6) (Stress-activated protein kinase 3) (Mitogen-activated protein kinase p38 gamma) (MAP kinase p38 gamma) Length = 367 Score = 32.3 bits (72), Expect = 1.3 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRD 578 R+L R TA EAL HP+F+ LRD Sbjct: 290 RMLVLDAEQRVTAAEALTHPYFESLRD 316
>MK12_BRARE (O42376) Mitogen-activated protein kinase 12 (EC 2.7.11.24)| (Stress-activated protein kinase 3) Length = 363 Score = 32.0 bits (71), Expect = 1.7 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 655 LLQYSPNLRCTAVEALVHPFFDELRDP 575 +L P R TA EAL PFF E R+P Sbjct: 289 MLLLDPESRITAAEALAFPFFSEFREP 315
>HOG1_ZYGRO (O93982) Mitogen-activated protein kinase HOG1 (EC 2.7.11.24) (MAP| kinase HOG1) Length = 380 Score = 32.0 bits (71), Expect = 1.7 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 R+L + P R TA +ALVHP+ DP Sbjct: 281 RMLVFDPKKRITAADALVHPYLAPYHDP 308
>CLK3_RAT (Q63117) Dual specificity protein kinase CLK3 (EC 2.7.12.1)| (CDC-like kinase 3) Length = 490 Score = 32.0 bits (71), Expect = 1.7 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFF 593 R+L++ P+ R T EAL+HPFF Sbjct: 451 RMLEFDPSQRITLAEALLHPFF 472
>CSK2A_MAIZE (P28523) Casein kinase II subunit alpha (EC 2.7.11.1) (CK II)| (CK2-alpha) Length = 332 Score = 31.6 bits (70), Expect = 2.2 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELR 581 +LL+Y R TA+EA+ HP+F ++R Sbjct: 298 KLLRYDHQERLTALEAMTHPYFQQVR 323
>CDC21_ORYSA (P29618) Cell division control protein 2 homolog 1 (EC 2.7.11.22)| Length = 294 Score = 31.6 bits (70), Expect = 2.2 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDEL 584 S++L+Y PN R TA +AL H +F +L Sbjct: 265 SKMLRYEPNKRITARQALEHEYFKDL 290
>TRIB1_HUMAN (Q96RU8) Tribbles homolog 1 (TRB-1) (SKIP1) (G-protein-coupled| receptor induced protein 2) (GIG-2) Length = 372 Score = 31.6 bits (70), Expect = 2.2 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -2 Query: 655 LLQYSPNLRCTAVEALVHPFFDELRDPG 572 LL+ P+ R TA E L+HP+F+ + +PG Sbjct: 318 LLRREPSERLTAPEILLHPWFESVLEPG 345
>CDC2_ORYLU (Q9DG98) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1) Length = 303 Score = 31.6 bits (70), Expect = 2.2 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDEL 584 +++L Y+P R +A EA+ HP+FD+L Sbjct: 265 AKMLIYNPPKRISAREAMTHPYFDDL 290
>CDC2_ORYLA (Q9DGD3) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1) Length = 303 Score = 31.6 bits (70), Expect = 2.2 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDEL 584 +++L Y+P R +A EA+ HP+FD+L Sbjct: 265 AKMLIYNPPKRISAREAMTHPYFDDL 290
>CDC2_ORYJA (Q9DGA2) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1) Length = 303 Score = 31.6 bits (70), Expect = 2.2 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDEL 584 +++L Y+P R +A EA+ HP+FD+L Sbjct: 265 AKMLIYNPPKRISAREAMTHPYFDDL 290
>CDC2_ORYCU (Q9DGA5) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1) Length = 303 Score = 31.6 bits (70), Expect = 2.2 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDEL 584 +++L Y+P R +A EA+ HP+FD+L Sbjct: 265 AKMLIYNPPKRISAREAMTHPYFDDL 290
>YDEE_SCHPO (Q10447) Hypothetical protein C12B10.14c in chromosome I| Length = 665 Score = 31.6 bits (70), Expect = 2.2 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +2 Query: 275 LTTQLHRSTGWSGHTSRLPTAIGSSSGSHAAQPTSPGEMLTCRCNSNES 421 L L++S ++ S LPT + S + S PT+P E+ T R +S+ S Sbjct: 166 LPIHLYKSYSYNHSPSSLPTVLNSQALSSPPVPTTPDEVSTNRLSSSTS 214
>CRK1_LEIME (Q06309) Cell division protein kinase 2 homolog CRK1 (EC 2.7.11.23)| Length = 301 Score = 31.6 bits (70), Expect = 2.2 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFF 593 RLL+Y P+ R TA +AL HP+F Sbjct: 276 RLLRYEPSERITAADALNHPYF 297
>CDC22_XENLA (P24033) Cell division control protein 2 homolog 2 (EC 2.7.11.22)| (EC 2.7.11.23) (p34 protein kinase 2) Length = 302 Score = 31.6 bits (70), Expect = 2.2 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDEL 584 S++L Y P R +A +A++HP+FD+L Sbjct: 265 SKMLVYDPAKRISARKAMLHPYFDDL 290
>CC2H1_TRYCO (P54664) Cell division control protein 2 homolog 1 (EC 2.7.11.22)| Length = 301 Score = 31.6 bits (70), Expect = 2.2 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFF 593 RLL+Y P R TA +AL HP+F Sbjct: 276 RLLRYEPGERLTAAQALEHPYF 297
>CDC2H_CRIFA (Q01917) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) Length = 474 Score = 31.2 bits (69), Expect = 2.9 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 R L Y PN R TA EA+ HP+ + + P Sbjct: 425 RCLMYEPNQRITAAEAVHHPYLERVPVP 452
>ERKA_DROME (P40417) Mitogen-activated protein kinase ERK-A (EC 2.7.11.24)| (Extracellular-regulated kinase A) (Protein rolled) Length = 376 Score = 31.2 bits (69), Expect = 2.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDPG 572 ++L ++P+ R EAL HP+ ++ DPG Sbjct: 305 KMLTFNPHKRIPVEEALAHPYLEQYYDPG 333
>CLK2_HUMAN (P49760) Dual specificity protein kinase CLK2 (EC 2.7.12.1)| (CDC-like kinase 2) Length = 499 Score = 31.2 bits (69), Expect = 2.9 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 655 LLQYSPNLRCTAVEALVHPFFDELR-DPGTRL 563 +L+Y P R T EAL HPFF LR +P +L Sbjct: 459 MLEYEPAKRLTLGEALQHPFFARLRAEPPNKL 490
>CDK3_HUMAN (Q00526) Cell division protein kinase 3 (EC 2.7.11.22)| Length = 305 Score = 31.2 bits (69), Expect = 2.9 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFF 593 +LLQY P+ R TA AL HP+F Sbjct: 265 QLLQYDPSQRITAKTALAHPYF 286
>MK12_RAT (Q63538) Mitogen-activated protein kinase 12 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 6) (ERK-6) (Stress-activated protein kinase 3) (Mitogen-activated protein kinase p38 gamma) (MAP kinase p38 gamma) Length = 367 Score = 31.2 bits (69), Expect = 2.9 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRD 578 ++L R TA EAL HP+F+ LRD Sbjct: 290 KMLVLDAEQRVTAAEALAHPYFESLRD 316
>YDYD_SCHPO (O13692) Hypothetical protein C11E3.13c precursor| Length = 510 Score = 31.2 bits (69), Expect = 2.9 Identities = 37/114 (32%), Positives = 50/114 (43%), Gaps = 8/114 (7%) Frame = +2 Query: 50 QQVAFN---NRNLEQGGTSLTIKKLGKSRGPIQGSTTINTFILL*NILQIS-YGNLNSQA 217 Q + FN N+ T+L S GP STTINT I+ I Q S G+ + + Sbjct: 382 QPLGFNAPSNQEFSANATALV------SPGPHSVSTTINTNIVQATISQSSTSGSSSGSS 435 Query: 218 RVSTREGEPVTWS----SLHRSILTTQLHRSTGWSGHTSRLPTAIGSSSGSHAA 367 ST S S S ++T ++G S H+S GSSSGS +A Sbjct: 436 SASTTASSSSVSSGSSISSGSSSMSTSYTSASGSSAHSS------GSSSGSSSA 483
>CDK2_XENLA (P23437) Cell division protein kinase 2 (EC 2.7.11.22) (CDC2| homolog Eg1 protein kinase) Length = 297 Score = 31.2 bits (69), Expect = 2.9 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTRL 563 +++LQY N R +A AL HPFF ++ P L Sbjct: 264 AQMLQYDSNKRISAKVALTHPFFRDVSRPTPHL 296
>CDC2_RANDY (Q9W739) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) (p34 protein kinase) Length = 302 Score = 31.2 bits (69), Expect = 2.9 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDEL 584 +++L Y P R +A +AL+HP+FD+L Sbjct: 265 AKMLVYDPAKRISARKALLHPYFDDL 290
>CDC7_HUMAN (O00311) Cell division cycle 7-related protein kinase (EC 2.7.11.1)| (CDC7-related kinase) (HsCdc7) (huCdc7) Length = 574 Score = 30.8 bits (68), Expect = 3.8 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDEL 584 +LL +P R TA EAL+HPFF ++ Sbjct: 548 KLLDLNPASRITAEEALLHPFFKDM 572
>CSK2A_THEPA (P28547) Casein kinase II subunit alpha (EC 2.7.11.1) (CK II)| Length = 348 Score = 30.8 bits (68), Expect = 3.8 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRD 578 R+L Y R T +EA+ HPFF+E+++ Sbjct: 319 RMLVYDHTKRITPLEAMEHPFFNEIKN 345
>CSK2A_THEAN (Q4U925) Casein kinase II subunit alpha (EC 2.7.11.1) (CK II)| (TaCKIIalpha) Length = 348 Score = 30.8 bits (68), Expect = 3.8 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRD 578 R+L Y R T +EA+ HPFF+E+++ Sbjct: 319 RMLVYDHTKRITPLEAMEHPFFNEIKN 345
>AFC1_ARATH (P51566) Serine/threonine-protein kinase AFC1 (EC 2.7.12.1)| Length = 467 Score = 30.8 bits (68), Expect = 3.8 Identities = 19/44 (43%), Positives = 22/44 (50%) Frame = -2 Query: 655 LLQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPPLFNFK 524 LL+Y P R A EAL HPFF R+ N P L+N K Sbjct: 423 LLRYDPTERFKAREALNHPFFTRSREQSIPPFNPNPHPFLYNQK 466
>KSS1_YEAST (P14681) Mitogen-activated protein kinase KSS1 (EC 2.7.11.24) (MAP| kinase KSS1) (Kinase suppressor of SST2) Length = 368 Score = 30.8 bits (68), Expect = 3.8 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 ++LQ++P+ R +A EAL HP+ DP Sbjct: 292 KMLQFNPDKRISAAEALRHPYLAMYHDP 319
>CLK2_MOUSE (O35491) Dual specificity protein kinase CLK2 (EC 2.7.12.1)| (CDC-like kinase 2) Length = 499 Score = 30.8 bits (68), Expect = 3.8 Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -2 Query: 655 LLQYSPNLRCTAVEALVHPFFDELR--DPGTRL 563 +L+Y P R T EAL HPFF LR P T+L Sbjct: 458 MLEYEPAKRLTLGEALQHPFFACLRTEPPNTKL 490
>CDC2H_PLAYO (Q7RM49) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) Length = 289 Score = 30.8 bits (68), Expect = 3.8 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDE 587 S++L+ PN R TA +A+ HP+F E Sbjct: 263 SKMLKLDPNQRITAKQAIEHPYFKE 287
>PHKG1_RABIT (P00518) Phosphorylase b kinase gamma catalytic chain, skeletal| muscle isoform (EC 2.7.11.19) (Phosphorylase kinase gamma subunit 1) Length = 386 Score = 30.8 bits (68), Expect = 3.8 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTR--LPNGRF 548 SR L P R TA EAL HPFF + R P G+F Sbjct: 265 SRFLVVQPQKRYTAEEALAHPFFQQYVVEEVRHFSPRGKF 304
>PHKG1_HUMAN (Q16816) Phosphorylase b kinase gamma catalytic chain, skeletal| muscle isoform (EC 2.7.11.19) (Phosphorylase kinase gamma subunit 1) Length = 386 Score = 30.8 bits (68), Expect = 3.8 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDPGTR--LPNGRF 548 SR L P R TA EAL HPFF + R P G+F Sbjct: 265 SRFLVVQPQNRYTAEEALAHPFFQQYLVEEVRHFSPRGKF 304
>CDC2H_PLACH (Q4Y4B1) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) Length = 288 Score = 30.8 bits (68), Expect = 3.8 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDE 587 S++L+ PN R TA +A+ HP+F E Sbjct: 262 SKMLKLDPNQRITAKQAIEHPYFKE 286
>CDC2H_PLABA (Q4Z6R1) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) Length = 288 Score = 30.8 bits (68), Expect = 3.8 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDE 587 S++L+ PN R TA +A+ HP+F E Sbjct: 262 SKMLKLDPNQRITAKQAIEHPYFKE 286
>PHO85_CANGA (Q6FKD4) Negative regulator of the PHO system (EC 2.7.11.22)| (Serine/threonine-protein kinase PHO85) Length = 302 Score = 30.8 bits (68), Expect = 3.8 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = -2 Query: 655 LLQYSPNLRCTAVEALVHPFFDE 587 LLQ +P++R +A +AL+HP+F E Sbjct: 276 LLQLNPDMRLSAKQALLHPWFSE 298
>CDC21_XENLA (P35567) Cell division control protein 2 homolog 1 (EC 2.7.11.22)| (EC 2.7.11.23) (p34 protein kinase 1) Length = 302 Score = 30.8 bits (68), Expect = 3.8 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDEL 584 +++L Y P R +A +AL+HP+FD+L Sbjct: 265 AKMLIYDPAKRISARKALLHPYFDDL 290
>CLK3_MOUSE (O35492) Dual specificity protein kinase CLK3 (EC 2.7.12.1)| (CDC-like kinase 3) Length = 490 Score = 30.8 bits (68), Expect = 3.8 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFF 593 R+L++ P R T EAL+HPFF Sbjct: 451 RMLEFDPAQRITLAEALLHPFF 472
>CLK3_HUMAN (P49761) Dual specificity protein kinase CLK3 (EC 2.7.12.1)| (CDC-like kinase 3) Length = 490 Score = 30.8 bits (68), Expect = 3.8 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFF 593 R+L++ P R T EAL+HPFF Sbjct: 451 RMLEFDPAQRITLAEALLHPFF 472
>HOG1_CANAL (Q92207) Mitogen-activated protein kinase HOG1 (EC 2.7.11.24) (MAP| kinase HOG1) Length = 377 Score = 30.4 bits (67), Expect = 4.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDELRDP 575 ++LL + P R +AV+ L HP+ + DP Sbjct: 283 AKLLVFDPKKRISAVQGLTHPYMEAYHDP 311
>MK07_HUMAN (Q13164) Mitogen-activated protein kinase 7 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 5) (ERK-5) (ERK4) (BMK1 kinase) Length = 815 Score = 30.4 bits (67), Expect = 4.9 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 R+L++ P+ R +A AL HPF + DP Sbjct: 325 RMLRFEPSARISAAAALRHPFLAKYHDP 352
>MK07_MOUSE (Q9WVS8) Mitogen-activated protein kinase 7 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 5) (ERK-5) (BMK1 kinase) Length = 806 Score = 30.4 bits (67), Expect = 4.9 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 R+L++ P+ R +A AL HPF + DP Sbjct: 326 RMLRFEPSARISAAAALRHPFLAKYHDP 353
>MHK_ARATH (P43294) Serine/threonine-protein kinase MHK (EC 2.7.11.22)| Length = 443 Score = 30.4 bits (67), Expect = 4.9 Identities = 24/62 (38%), Positives = 28/62 (45%), Gaps = 13/62 (20%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFD-------ELRDPGTRLPNGRFLPPL------FNFKP 521 +RL + P R TA EAL HPFF + D RL N LP L FN +P Sbjct: 269 NRLCSWDPLKRPTADEALNHPFFSMATQASYPIHDLELRLDNMAALPNLELNLWDFNREP 328 Query: 520 NE 515 E Sbjct: 329 EE 330
>DYR1A_RAT (Q63470) Dual specificity tyrosine-phosphorylation-regulated kinase| 1A (EC 2.7.12.2) (Protein kinase minibrain homolog) (MNBH) (RP86) (Dual specificity YAK1-related kinase) Length = 763 Score = 30.0 bits (66), Expect = 6.5 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPN 557 R+L Y P R AL H FF + D GT N Sbjct: 458 RMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSN 491
>DYR1A_MOUSE (Q61214) Dual specificity tyrosine-phosphorylation-regulated kinase| 1A (EC 2.7.12.1) (Protein kinase minibrain homolog) (MNBH) (MP86) (Dual specificity YAK1-related kinase) Length = 763 Score = 30.0 bits (66), Expect = 6.5 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPN 557 R+L Y P R AL H FF + D GT N Sbjct: 458 RMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSN 491
>DYR1A_HUMAN (Q13627) Dual specificity tyrosine-phosphorylation-regulated kinase| 1A (EC 2.7.12.1) (Protein kinase minibrain homolog) (MNBH) (HP86) (Dual specificity YAK1-related kinase) Length = 763 Score = 30.0 bits (66), Expect = 6.5 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDPGTRLPN 557 R+L Y P R AL H FF + D GT N Sbjct: 458 RMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSN 491
>CPK1_CRYNE (Q8NK05) Mitogen-activated protein kinase CPK1 (EC 2.7.11.24)| (Stress-activated protein kinase CPK1) Length = 366 Score = 30.0 bits (66), Expect = 6.5 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -2 Query: 652 LQYSPNLRCTAVEALVHPFFDELRDPGTRLPNGRFLPP-LFNFKPNELK 509 L +SP+ R T EAL+H + + DP PN L P F+F+ ++ K Sbjct: 290 LTFSPSKRITVEEALMHSYVEAYHDPHDE-PNAEPLKPGFFDFEFHQEK 337
>CLK1_MOUSE (P22518) Dual specificity protein kinase CLK1 (EC 2.7.12.1)| (CDC-like kinase 1) (Protein kinase STY) Length = 483 Score = 30.0 bits (66), Expect = 6.5 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELR 581 ++L+Y P R T EAL HPFF L+ Sbjct: 455 KILEYDPAKRITLKEALKHPFFYPLK 480
>CAC1F_MOUSE (Q9JIS7) Voltage-dependent L-type calcium channel alpha-1F subunit| (Voltage-gated calcium channel alpha subunit Cav1.4) Length = 1985 Score = 30.0 bits (66), Expect = 6.5 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 3/80 (3%) Frame = +2 Query: 263 HRSILTTQLHRSTG---WSGHTSRLPTAIGSSSGSHAAQPTSPGEMLTCRCNSNESDTGI 433 HR L+ +R G W H++R S+ SHA+ P S +T + + G Sbjct: 436 HRPQLSELTNRRRGRLRWFSHSTRST----HSTSSHASLPASDTGSMTDTPGDEDEEEGT 491 Query: 434 S*SCMGALLSRVLRDQFCRN 493 SC L+++++ + CR+ Sbjct: 492 MASCT-RCLNKIMKTRICRH 510
>PHO85_ASHGO (Q751E8) Negative regulator of the PHO system (EC 2.7.11.22)| (Serine/threonine-protein kinase PHO85) Length = 303 Score = 30.0 bits (66), Expect = 6.5 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = -2 Query: 655 LLQYSPNLRCTAVEALVHPFFDE 587 LLQ +P++R +A +AL HP F+E Sbjct: 279 LLQLNPSMRLSAQQALSHPLFEE 301
>AFC3_ARATH (P51568) Serine/threonine-protein kinase AFC3 (EC 2.7.12.1)| Length = 400 Score = 30.0 bits (66), Expect = 6.5 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 655 LLQYSPNLRCTAVEALVHPFF 593 LL Y P+ R TA EAL HPFF Sbjct: 376 LLAYDPSERLTANEALDHPFF 396
>CDC2_CARAU (P51958) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1) Length = 302 Score = 30.0 bits (66), Expect = 6.5 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDEL 584 +++L Y P R +A +A+ HP+FD+L Sbjct: 265 TKMLIYDPPKRISARQAMTHPYFDDL 290
>CC2H1_TRYBB (P38973) Cell division control protein 2 homolog 1 (EC 2.7.11.22)| Length = 301 Score = 30.0 bits (66), Expect = 6.5 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -2 Query: 655 LLQYSPNLRCTAVEALVHPFF 593 LL+Y P+ R TA +AL HP+F Sbjct: 277 LLRYEPSERLTAAQALEHPYF 297
>AFC2_ARATH (P51567) Serine/threonine-protein kinase AFC2 (EC 2.7.12.1)| Length = 427 Score = 29.6 bits (65), Expect = 8.4 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 655 LLQYSPNLRCTAVEALVHPFFDELR 581 LL++ P+ R TA EAL HPFF R Sbjct: 403 LLRFDPSERITAREALRHPFFARRR 427
>TRIB1_MOUSE (Q8K4K4) Tribbles homolog 1 (TRB-1)| Length = 372 Score = 29.6 bits (65), Expect = 8.4 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = -2 Query: 655 LLQYSPNLRCTAVEALVHPFFDELRDPG 572 LL+ P+ R TA + L+HP+F+ + +PG Sbjct: 318 LLRREPSERLTAPQILLHPWFEYVLEPG 345
>PHO85_CANAL (Q9HGY5) Negative regulator of the PHO system (EC 2.7.11.22)| (Serine/threonine-protein kinase PHO85) (CaPHO85) Length = 326 Score = 29.6 bits (65), Expect = 8.4 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -2 Query: 655 LLQYSPNLRCTAVEALVHPFFDELRDP 575 LLQ P R TA +AL HP+F E+ P Sbjct: 270 LLQMRPESRITARQALQHPWFHEITMP 296
>MK14A_CYPCA (Q90336) Mitogen-activated protein kinase 14a (EC 2.7.11.24)| (Mitogen-activated protein kinase p38a) (MAP kinase p38a) (cp38a) Length = 361 Score = 29.6 bits (65), Expect = 8.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 ++L + R TA EAL HP+F + DP Sbjct: 288 KMLVLDTDKRITAAEALAHPYFAQYHDP 315
>MK14A_BRARE (Q9DGE2) Mitogen-activated protein kinase 14a (EC 2.7.11.24)| (Mitogen-activated protein kinase p38a) (MAP kinase p38a) (zp38a) Length = 361 Score = 29.6 bits (65), Expect = 8.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 658 RLLQYSPNLRCTAVEALVHPFFDELRDP 575 ++L + R TA EAL HP+F + DP Sbjct: 288 KMLVLDTDKRITAAEALAHPYFAQYHDP 315
>CDC2H_PLAKH (O96821) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) Length = 288 Score = 29.6 bits (65), Expect = 8.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDE 587 S++L+ PN R TA EAL H +F E Sbjct: 262 SKMLRLDPNQRITAKEALQHAYFKE 286
>CDC2B_ARATH (P25859) Cell division control protein 2 homolog B (EC 2.7.11.22)| (EC 2.7.11.23) Length = 309 Score = 29.6 bits (65), Expect = 8.4 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -2 Query: 661 SRLLQYSPNLRCTAVEALVHPFFDEL 584 +++L+Y+P R +A AL HP+FD L Sbjct: 279 TKMLKYNPAERISAKTALDHPYFDSL 304 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,799,354 Number of Sequences: 219361 Number of extensions: 1928069 Number of successful extensions: 5605 Number of sequences better than 10.0: 125 Number of HSP's better than 10.0 without gapping: 5403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5596 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)