| Clone Name | rbags23b01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TBL3_HUMAN (Q12788) WD-repeat protein SAZD (Transducin beta-like... | 30 | 4.8 | 2 | SPEA_DEIRA (Q9RXR4) Biosynthetic arginine decarboxylase (EC 4.1.... | 30 | 6.3 | 3 | END4_BIFLO (Q8G689) Probable endonuclease 4 (EC 3.1.21.2) (Endon... | 29 | 8.2 | 4 | MRP11_ARATH (Q9SKX0) Multidrug resistance-associated protein 11 ... | 29 | 8.2 |
|---|
>TBL3_HUMAN (Q12788) WD-repeat protein SAZD (Transducin beta-like 3 protein)| Length = 519 Score = 30.0 bits (66), Expect = 4.8 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = +2 Query: 11 SPTNNSLPWMNCTGKLTELHAR*RCTACPARSHGRSTSSIMSHLKGTLLNC 163 S ++SLPW C + +L A P+ S TS++ HL+GT+L C Sbjct: 410 SGASSSLPWTRCWPR-PQLMA-------PSSSGHSRTSAVSRHLRGTMLLC 452
>SPEA_DEIRA (Q9RXR4) Biosynthetic arginine decarboxylase (EC 4.1.1.19) (ADC)| Length = 662 Score = 29.6 bits (65), Expect = 6.3 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 92 CPARSHGRSTSSIMSHLKGTLLNCNPVNNFYTN 190 CPAR T+S+ +H + + NP+N +T+ Sbjct: 2 CPARLRTPRTASLPTHRRSAMTTANPLNTSFTS 34
>END4_BIFLO (Q8G689) Probable endonuclease 4 (EC 3.1.21.2) (Endonuclease IV)| (Endodeoxyribonuclease IV) Length = 283 Score = 29.3 bits (64), Expect = 8.2 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -1 Query: 453 HAGCGSHIAVQLTPSCNSHSWSRADGVQFRMLSHAVKGSNCKFNADRFLT 304 H G G+ +L + + RADGV + + A KG+ C N D T Sbjct: 117 HVGQGAETGCRLISEGLNQVFERADGVMVLLETMAGKGTECGRNFDELAT 166
>MRP11_ARATH (Q9SKX0) Multidrug resistance-associated protein 11 (EC 3.6.3.44)| (Glutathione S-conjugate transporting ATPase 11) (ATP-energized glutathione S-conjugate pump 11) Length = 1194 Score = 29.3 bits (64), Expect = 8.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 296 QTQVRNLSALNLQLLPFTACDNILNC 373 Q ++ NL L ++ PFT C+N+L C Sbjct: 8 QLELENLLTLPPEMDPFTCCENLLRC 33 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,618,712 Number of Sequences: 219361 Number of extensions: 1877049 Number of successful extensions: 4655 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4655 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4757699440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)