| Clone Name | rbags22j05 |
|---|---|
| Clone Library Name | barley_pub |
>SC24A_HUMAN (O95486) Protein transport protein Sec24A (SEC24-related protein A)| (Fragment) Length = 1078 Score = 31.2 bits (69), Expect = 2.6 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 4/41 (9%) Frame = -3 Query: 576 STPQRFWLPLLHDSVKLLNCKPH----PLLNVAETTLLLNK 466 STP + +P LH+ ++ LNC P L ++ +T LLNK Sbjct: 347 STPLKPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNK 387
>POLG_HCVEU (O39927) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3017 Score = 31.2 bits (69), Expect = 2.6 Identities = 27/80 (33%), Positives = 35/80 (43%), Gaps = 10/80 (12%) Frame = -3 Query: 558 WLPLLH-----DSVKLLNCKPHPLLNVAETTLLLNKLQEL-----SMAKLRPDFCSNHLP 409 W+P L DS+ LL C HP L T +LL L L S+ K+ P F H+ Sbjct: 863 WVPDLRVRGGRDSIILLTCLLHPQLGFEVTKILLAVLAPLYILQYSLLKV-PYFVRAHIL 921 Query: 408 IHALSSVRLALGSNLARAIL 349 + A VR G +A L Sbjct: 922 LRACLLVRRLAGGKYVQACL 941
>POLG_HCV6A (Q5I2N3) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3018 Score = 30.8 bits (68), Expect = 3.4 Identities = 27/80 (33%), Positives = 35/80 (43%), Gaps = 10/80 (12%) Frame = -3 Query: 558 WLPLLH-----DSVKLLNCKPHPLLNVAETTLLLNKLQEL-----SMAKLRPDFCSNHLP 409 W+P L DS+ LL C HP L T +LL L L S+ K+ P F H+ Sbjct: 864 WVPDLRVRGGRDSIILLTCLLHPQLGFEVTKILLAILAPLYILQYSLLKV-PYFVRAHIL 922 Query: 408 IHALSSVRLALGSNLARAIL 349 + A VR G +A L Sbjct: 923 LRACLLVRRLAGGRYVQACL 942
>MURB_AGRT5 (Q8UDN0) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 321 Score = 30.0 bits (66), Expect = 5.8 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Frame = +3 Query: 297 RHQTGA----NPPPDTAFKLLQEWHGRGLIPGPT*QSSVH 404 R QTG NP +A++L+ E GRGL+ G SS+H Sbjct: 226 REQTGGSTFKNPEGHSAWELIDEAGGRGLVIGGAQMSSLH 265
>NELFD_DROME (Q24134) Negative elongation factor D| Length = 578 Score = 29.3 bits (64), Expect = 10.0 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -3 Query: 549 LLHDSVKLLNCKPHPLLNVAETTLLLNKLQELSMAKLRPDFCSNHLPI 406 L+ + L NC +P++ V + N + E S KL D C HL + Sbjct: 396 LIAELQTLYNCIKYPVVGVGVIRWIENVVMEPSYFKLSTDSCPTHLAV 443 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,749,779 Number of Sequences: 219361 Number of extensions: 1773051 Number of successful extensions: 4124 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3958 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4123 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5767334219 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)