| Clone Name | rbags22i08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YR840_MIMIV (Q5URB9) Putative ankyrin repeat protein R840 | 32 | 1.4 | 2 | MRAY_CORDI (Q6NGC5) Phospho-N-acetylmuramoyl-pentapeptide-transf... | 30 | 5.4 | 3 | IBP1_BOVIN (P24591) Insulin-like growth factor-binding protein 1... | 29 | 7.1 | 4 | SECB_BRAJA (Q89WN7) Protein-export protein secB | 29 | 9.2 |
|---|
>YR840_MIMIV (Q5URB9) Putative ankyrin repeat protein R840| Length = 526 Score = 31.6 bits (70), Expect = 1.4 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -1 Query: 330 VDLFKYLLPNGVDVKSHLAYVAALAC 253 +++ KYL+ NGVD++S Y +AC Sbjct: 122 IEVVKYLIDNGVDIRSEKNYAVRIAC 147
>MRAY_CORDI (Q6NGC5) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 366 Score = 29.6 bits (65), Expect = 5.4 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 5/66 (7%) Frame = -1 Query: 411 PGTT*HGWLPRLPTCPLEIGPLQKG-RIVDLFKYLL----PNGVDVKSHLAYVAALACTT 247 PG++ +L LPT L IGP G I LF Y+L N V++ L +AA + Sbjct: 145 PGSSHLSFLRDLPTVDLAIGPKAVGIAIFLLFIYILISAWSNAVNLTDGLDGLAAGSTAI 204 Query: 246 ILGVFT 229 ++G +T Sbjct: 205 VMGTYT 210
>IBP1_BOVIN (P24591) Insulin-like growth factor-binding protein 1 precursor| (IGFBP-1) (IBP-1) (IGF-binding protein 1) Length = 263 Score = 29.3 bits (64), Expect = 7.1 Identities = 20/57 (35%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = -2 Query: 254 AQRFWVCSH-PAFCPSAARSA*CGFITLAWTS*IAVCCHGTPSKYVHISCSILSNEP 87 A+R +C PA CP RSA CG + A C T +SC L EP Sbjct: 37 AERMALCPPVPASCPELTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEP 93
>SECB_BRAJA (Q89WN7) Protein-export protein secB| Length = 161 Score = 28.9 bits (63), Expect = 9.2 Identities = 11/42 (26%), Positives = 28/42 (66%) Frame = +3 Query: 237 HPKSLCMLKRQHKPGEISHLLRLGANT*TDQQFSLSVGVQSR 362 +P + L++Q +P +I+ + +GAN ++Q+F +++ V+ + Sbjct: 31 NPNAPSSLQQQGQPPQINIQINVGANNLSEQEFEVTLSVEGK 72 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,213,282 Number of Sequences: 219361 Number of extensions: 1936023 Number of successful extensions: 4393 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4393 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4085413911 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)