| Clone Name | rbags22i03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HR1A_TRIFL (Q8JIR2) Hemorrhagic metalloproteinase HR1a precursor... | 29 | 9.1 | 2 | NTCP_HUMAN (Q14973) Sodium/bile acid cotransporter (Na(+)/bile a... | 29 | 9.1 |
|---|
>HR1A_TRIFL (Q8JIR2) Hemorrhagic metalloproteinase HR1a precursor (EC 3.4.24.-)| [Contains: Disintegrin-like 1a] Length = 609 Score = 29.3 bits (64), Expect = 9.1 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 506 PCCSAACCCIHSWL 465 PCC AA C +HSW+ Sbjct: 429 PCCDAATCKLHSWV 442
>NTCP_HUMAN (Q14973) Sodium/bile acid cotransporter (Na(+)/bile acid| cotransporter) (Na(+)/taurocholate transport protein) (Sodium/taurocholate cotransporting polypeptide) (Solute carrier family 10 member 1) Length = 349 Score = 29.3 bits (64), Expect = 9.1 Identities = 20/72 (27%), Positives = 34/72 (47%) Frame = -1 Query: 598 LIGVILTTLLCASPIGQVAEVLKTQGAQLILPVALLHAVAFTLGYWMSKWSSFGESTSRT 419 L+ + T+L A +G+ ++ LI +L+ + F LGY +S RT Sbjct: 196 LLCSVAVTVLSAINVGK--SIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRT 253 Query: 418 ISIECGMQSSAL 383 +S+E G Q+ L Sbjct: 254 VSMETGCQNVQL 265 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,395,325 Number of Sequences: 219361 Number of extensions: 1510469 Number of successful extensions: 3612 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3597 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5253413348 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)