| Clone Name | rbags22h15 |
|---|---|
| Clone Library Name | barley_pub |
>PGK2_METJA (Q58877) 2-phosphoglycerate kinase (EC 2.7.2.-) (2PGK)| Length = 309 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 150 LEGHCILIQTAHIIPRLXKQMNYLSSFXAYLRWTYLPHEMHLPEF 284 +EG ++I+ H++P L K +S ++ T E+H F Sbjct: 186 VEGQSVIIEGTHLVPTLLKDKYLENSHVVFIMLTIYNEELHKMRF 230
>YG2M_YEAST (P53255) Hypothetical 58.2 kDa protein in DBF2-VAS1 intergenic| region Length = 507 Score = 28.5 bits (62), Expect = 4.2 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 6/71 (8%) Frame = +3 Query: 141 DVKLEGHCILIQTAHIIPRL--XKQMNYLSSFXAY----LRWTYLPHEMHLPEFGPCFQK 302 D+ + GHC++I H IP+L K S AY ++ Y+ +M F ++ Sbjct: 305 DMDISGHCLIIPIEH-IPKLDPSKNAELTQSILAYEASLVKMNYIKFDMCTIVFEIQSER 363 Query: 303 QIHHSRLWVPL 335 IH + +P+ Sbjct: 364 SIHFHKQVIPV 374
>DLT_DROME (Q8T626) Protein disks lost (Protein vanaso) (Codanin 1 homolog)| Length = 1240 Score = 28.5 bits (62), Expect = 4.2 Identities = 20/50 (40%), Positives = 25/50 (50%) Frame = +2 Query: 179 STYYSALVKADELFELFXGISSMDLFASRDASPRVWXLFSETNSPFSTLG 328 S S ++AD L ELF M LFA + SP+VW + SE S G Sbjct: 1161 SMLQSGAIRADHLNELF-----MPLFAE-NWSPKVWCMLSELLQQLSLSG 1204
>PANC_ENTFA (Q833S6) Pantoate--beta-alanine ligase (EC 6.3.2.1) (Pantothenate| synthetase) (Pantoate-activating enzyme) Length = 282 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +2 Query: 71 PSVMQLYF*NAKPAIRVLPXXKSRCKTGRPLHFDSNSTYYSAL 199 P V ++Y NA + + + C RP+HF T S L Sbjct: 93 PEVEEMYCDNASTFVNITGLTEGLCGASRPIHFRGVCTVVSKL 135
>COLX_ARATH (Q9C9F4) Putative zinc finger protein At1g68190| Length = 356 Score = 27.7 bits (60), Expect = 7.2 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = +2 Query: 170 DSNSTYY-SALVKADELFELFXGISSMDLFASRDASPRVWXLFSETNSPFS 319 DSN+ ++ S+L K+ E+ + F + +FA + AS + SET++P+S Sbjct: 270 DSNNVFFVSSLDKSHEM-KTFSSSFNNPIFAPKPASSTISFSSSETDNPYS 319
>GIDA_VIBCH (Q9KNG4) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gidA (Glucose-inhibited division protein A) Length = 631 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 113 IRVLPXXKSRCKTGRPLHFDSNSTYYSAL 199 +R LP R KTG P D+NS +S L Sbjct: 187 LRELPFRVDRLKTGTPPRIDANSVDFSVL 215
>RSC2_YEAST (Q06488) Chromatin structure remodeling complex protein RSC2| (Remodel the structure of chromatin complex subunit 2) Length = 889 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 72 HLLCNYISKMRSQLFEFYQXANQDVKLEG 158 HL+ N + K F YQ N D+KLEG Sbjct: 478 HLVSNLVGKCYVIHFTRYQRGNPDMKLEG 506 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,737,226 Number of Sequences: 219361 Number of extensions: 882756 Number of successful extensions: 2105 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2075 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2105 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)