| Clone Name | rbaal0g04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | STSYN_PEA (Q93XK2) Stachyose synthase precursor (EC 2.4.1.67) (G... | 40 | 2e-06 | 2 | SKP2_HUMAN (Q13309) S-phase kinase-associated protein 2 (F-box p... | 30 | 5.1 | 3 | SODM_DROME (Q00637) Superoxide dismutase [Mn], mitochondrial pre... | 30 | 6.6 |
|---|
>STSYN_PEA (Q93XK2) Stachyose synthase precursor (EC 2.4.1.67)| (Galactinol--raffinose galactosyltransferase) Length = 853 Score = 40.0 bits (92), Expect(2) = 2e-06 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -2 Query: 669 ETAVYAFNSCSLSRLQ-KHQSLELSLVTMACEIYTISPIQVYGGAVGFAPLGLLNMFNSG 493 E VY + LS + K + ++ ++ E+Y+ P+ G + FAP+GL NMFNSG Sbjct: 723 EYVVYLNQAEELSLMTLKSEPIQFTIQPSTFELYSFVPVTKLCGGIKFAPIGLTNMFNSG 782 Score = 30.8 bits (68), Expect(2) = 2e-06 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -3 Query: 440 QIKCRGPGRFGAYSSARPALCRVDANEVEFSHSDDGLLAFDL 315 +IK +G G F AYSS P +++ EV+F DG L ++ Sbjct: 796 KIKVKGGGSFLAYSSESPKKFQLNGCEVDFEWLGDGKLCVNV 837
>SKP2_HUMAN (Q13309) S-phase kinase-associated protein 2 (F-box protein Skp2)| (Cyclin A/CDK2-associated protein p45) (p45skp2) (F-box/LRR-repeat protein 1) Length = 424 Score = 30.4 bits (67), Expect = 5.1 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 1/88 (1%) Frame = -1 Query: 565 ITDTGLRWGCWVCATWTAKHVQLRVAHSTVSDAQLILQLRQFRSNAEGQDVLGRIHPLGR 386 + + L W C +T KHVQ+ VAH VS+ L L +R N + D + L R Sbjct: 258 LDELNLSW----CFDFTEKHVQVAVAH--VSETITQLNLSGYRKNLQKSD----LSTLVR 307 Query: 385 HSAELMRMR*S-SVILMMACWHLISQMD 305 L+ + S SV+L C+ Q++ Sbjct: 308 RCPNLVHLDLSDSVMLKNDCFQEFFQLN 335
>SODM_DROME (Q00637) Superoxide dismutase [Mn], mitochondrial precursor (EC| 1.15.1.1) Length = 217 Score = 30.0 bits (66), Expect = 6.6 Identities = 16/61 (26%), Positives = 30/61 (49%) Frame = +1 Query: 82 EHTLLLNPVRRVIVSEAGRQQLRRNHHDINISNWSREMNGAEQKLQQEKSRSHTVSGLQQ 261 +HTL P + +++ HH + + +N AE++L++ KS+S T +Q Sbjct: 18 KHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEEAKSKSDTTKLIQL 77 Query: 262 A 264 A Sbjct: 78 A 78 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,540,437 Number of Sequences: 219361 Number of extensions: 2135178 Number of successful extensions: 4668 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4667 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6541540170 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)