| Clone Name | rbags22g24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FABH_BRAJA (Q89K89) 3-oxoacyl-[acyl-carrier-protein] synthase 3 ... | 30 | 2.1 |
|---|
>FABH_BRAJA (Q89K89) 3-oxoacyl-[acyl-carrier-protein] synthase 3 (EC 2.3.1.41)| (3-oxoacyl-[acyl-carrier-protein] synthase III) (Beta-ketoacyl-ACP synthase III) (KAS III) Length = 326 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 112 HTSNQQKVQTSTHALHSCGQFACLMVTRHGSFSXA 216 H +N++ + S H LH + L V RHG+ S A Sbjct: 253 HQANKRIIDASAHKLHIAPEKVVLTVDRHGNTSAA 287 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,291,481 Number of Sequences: 219361 Number of extensions: 623819 Number of successful extensions: 1454 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1453 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)